KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0554Help
Entry
SAHV_0554         CDS       T00588                                 

Definition
(GenBank) hypothetical protein
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw00230  Purine metabolism
saw00240  Pyrimidine metabolism
saw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SAHV_0554
   00240 Pyrimidine metabolism
    SAHV_0554
Enzymes [BR:saw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     SAHV_0554
    2.7.1.76  2'-deoxyadenosine kinase
     SAHV_0554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_17 AAA_15 AAA_28 Cytidylate_kin2 RsgA_GTPase ABC_tran TsaE AAA_22 ATPase RNA_helicase MMR_HSR1 AAA_33 NB-ARC AAA Cytidylate_kin AAA_14 AAA_16 AAA_29 AAA_25 PduV-EutP ATP_bind_1 GTP_EFTU NACHT NTPase_1 DUF1087 APS_kinase ParA AAA_5
Motif
Other DBs
NCBI-ProteinID: BAF77437
Position
complement(627066..627728)
Genome map
AA seq 220 aa AA seqDB search
MNNYGIPQNAIITIAGTVGVGKSTLTQALADKLNFKTSFENVEHNPYLDKFYSDFERWSF
HLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDVDIFAKMHEEEGTMSKEDFKTYSDLFN
AMVMTPYFPKPDVMIYLECNYDEVIDRIIERGREMEINTDPEYWKKLFKRYDDWINSFNA
CPVVRININEYDIHKDPESLNPMIDKIARIIQTYRQVDTR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaataattacggtattccacaaaatgccattataaccattgcaggtacagttggtgtt
ggaaaatcaacactaacgcaagcacttgcagataaattaaactttaaaacgtcttttgaa
aatgtcgaacataatccatatttagataaattttatagcgattttgaacgatggagtttc
catttgcaaatttacttcttagctgaacgttttaaagaacaaaagcgtatgtttgaatat
ggtggtggctttgtccaagatcgatcaatttatgaagatgttgatatttttgcaaaaatg
catgaagaagaaggcacaatgagtaaagaagatttcaaaacatattcagacttatttaat
gccatggtcatgacaccttattttcctaaaccagatgtaatgatttatttagaatgtaac
tatgatgaggtcattgatcgtattattgaacgtggtcgcgaaatggaaattaatacagac
cctgaatactggaaaaagctatttaaacgctatgacgattggattaatagctttaatgca
tgtccagttgtacgtatcaatattaatgaatatgatatccataaggaccccgaatcttta
aatcctatgatagacaaaattgctcgaattattcaaacatatcgacaagtagatacacga
taa

DBGET integrated database retrieval system