KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0568Help
Entry
SAHV_0568         CDS       T00588                                 

Definition
(GenBank) hypothetical protein
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw00030  Pentose phosphate pathway
saw00680  Methane metabolism
saw01100  Metabolic pathways
saw01120  Microbial metabolism in diverse environments
saw01200  Carbon metabolism
saw01230  Biosynthesis of amino acids
Module
saw_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
saw_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:saw00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SAHV_0568
  Energy metabolism
   00680 Methane metabolism
    SAHV_0568
Enzymes [BR:saw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     SAHV_0568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase Ribul_P_3_epim TMP-TENI His_biosynth PRAI PcrB ThiG
Motif
Other DBs
NCBI-ProteinID: BAF77451
Position
648646..649278
Genome map
AA seq 210 aa AA seqDB search
MELQLAIDLLNKEDAAELANKVKDYVDIVEIGTPIIYNEGLPAVKHMADNISNVKVLADM
KIMDAADYEVSQAIKFGADVITILGVAEDASIKAAIEEAHKNNKQLLVDMIAVQDLEKRA
KELDEMGADYIAVHTGYDLQAEGQSPLESLRTVKSVIKNSKVAVAGGIKPDTIKDIVAES
PDLVIVGGGIANADDPVEAAKQCRAAIEGK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtggaattacaattagcaattgatttattaaacaaagaagacgcggctgagttagcaaat
aaagtaaaagattatgtagatatcgtagaaatcggtacgccaatcatttacaacgaaggt
ttaccagcagttaaacatatggcagacaacattagtaatgtaaaagtattagcagacatg
aaaattatggatgcagctgattatgaagttagccaagcaattaaatttggcgcggatgta
attacaatactaggtgttgcagaagatgcatcaattaaagcagctattgaagaagctcat
aaaaataataaacaattactagttgatatgattgctgttcaagatttagaaaaacgtgca
aaagaactagatgaaatgggtgctgattatattgcagtacacactggttatgatttacaa
gcagaagggcaatcaccattagaaagtttaagaaccgttaaatctgttattaaaaattct
aaagttgcagtagcaggtggaattaaaccagatacaattaaagatattgtcgctgaaagt
cctgatcttgttattgttggtggcggaatcgcaaatgcagatgatccagtagaagctgca
aaacaatgtcgcgctgcaatcgaaggtaagtaa

DBGET integrated database retrieval system