KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0569Help
Entry
SAHV_0569         CDS       T00588                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K08094  6-phospho-3-hexuloisomerase [EC:5.3.1.27]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw00030  Pentose phosphate pathway
saw00680  Methane metabolism
saw01100  Metabolic pathways
saw01120  Microbial metabolism in diverse environments
saw01200  Carbon metabolism
saw01230  Biosynthesis of amino acids
Module
saw_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
saw_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:saw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SAHV_0569
  09102 Energy metabolism
   00680 Methane metabolism
    SAHV_0569
Enzymes [BR:saw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.27  6-phospho-3-hexuloisomerase
     SAHV_0569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS SIS_2 Formyl_trans_N
Motif
Other DBs
NCBI-ProteinID: BAF77452
Position
649280..649828
Genome map
AA seq 182 aa AA seqDB search
MAKFSDYQLILDELKMTLSHVEADEFSTFASKILHAEHIFVAGKGRSGFVANSFAMRLNQ
LGKQAHVVGESTTPAIKSNDVFVIISGSGSTEHLRLLADKAKSVGADIVLITTNKDSAIG
NLAGTNIVLPAGTKYDEQGSAQPLGSLFEQASQLFLDSVVMGLMTEMNVTEQTMQQNHAN
LE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggctaaatttagtgactatcaattaattctagatgaattaaagatgactttgtcacat
gttgaagcggatgagttttcaacttttgcatccaaaatactacatgctgaacatatattt
gtagctggcaaaggacgttcaggattcgtggcgaatagttttgcaatgcgcttaaatcag
ctcggcaaacaggcacatgttgttggagaatcaacgacacctgcgattaagtcgaatgat
gtatttgtaattatctctggttcaggttccacggaacatttaagattattagcagacaaa
gcaaaatcagtaggtgctgacatcgtattaattactacaaataaagattctgcaataggc
aatctagctgggacgaacatcgttttgcctgcaggtacaaaatatgatgaacaaggctcg
gcacaaccattaggaagtttgtttgaacaagcatctcaattatttttagatagtgttgta
atgggattgatgactgaaatgaatgttacggaacaaacgatgcaacaaaatcatgctaat
ttagaataa

DBGET integrated database retrieval system