KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0574Help
Entry
SAHV_0574         CDS       T00588                                 

Gene name
vraB
Definition
(GenBank) acetyl-CoA c-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw00071  Fatty acid degradation
saw00072  Synthesis and degradation of ketone bodies
saw00280  Valine, leucine and isoleucine degradation
saw00310  Lysine degradation
saw00362  Benzoate degradation
saw00380  Tryptophan metabolism
saw00620  Pyruvate metabolism
saw00630  Glyoxylate and dicarboxylate metabolism
saw00640  Propanoate metabolism
saw00650  Butanoate metabolism
saw00900  Terpenoid backbone biosynthesis
saw01100  Metabolic pathways
saw01110  Biosynthesis of secondary metabolites
saw01120  Microbial metabolism in diverse environments
saw01130  Biosynthesis of antibiotics
saw01200  Carbon metabolism
saw01212  Fatty acid metabolism
saw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAHV_0574 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    SAHV_0574 (vraB)
   00640 Propanoate metabolism
    SAHV_0574 (vraB)
   00650 Butanoate metabolism
    SAHV_0574 (vraB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAHV_0574 (vraB)
   00072 Synthesis and degradation of ketone bodies
    SAHV_0574 (vraB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAHV_0574 (vraB)
   00310 Lysine degradation
    SAHV_0574 (vraB)
   00380 Tryptophan metabolism
    SAHV_0574 (vraB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAHV_0574 (vraB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAHV_0574 (vraB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAHV_0574 (vraB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saw04147]
    SAHV_0574 (vraB)
Enzymes [BR:saw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAHV_0574 (vraB)
Exosome [BR:saw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAHV_0574 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAF77457
UniProt: Q9KWK4
Position
654412..655551
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgcttaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatc
caagccggagctggcaaggtatatattgcaggtggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtggcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaactg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaatactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtaatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtagttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgactcgattattttatatgtttgacaaagagactatg
attgcatctatggggatagggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system