KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0579Help
Entry
SAHV_0579         CDS       T00588                                 

Gene name
ung
Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:saw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SAHV_0579 (ung)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:saw03400]
    SAHV_0579 (ung)
Enzymes [BR:saw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     SAHV_0579 (ung)
DNA repair and recombination proteins [BR:saw03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SAHV_0579 (ung)
 Prokaryotic Type
     SAHV_0579 (ung)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: BAF77462
UniProt: A7WZ22
Structure
PDB: 

Position
658052..658708
Genome map
AA seq 218 aa AA seqDB search
MEWSQIFHDITTKHDFKAMHDFLEKEYSTAIVYPDRENIYQAFDLTPFENIKVVILGQDP
YHGPNQAHGLAFSVQPNAKFPPSLRNMYKELADDIGCVRQTPHLQDWAREGVLLLNTVLT
VRQGEANSHRDIGWETFTDEIIKAVSDYKEHVVFILWGKPAQQKIKLIDTSKHCIIKSVH
PSPLSAYRGFFGSKPYSKANAYLESVGKSPINWCESEA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggaatggtcgcaaatttttcatgacataacaacgaaacatgactttaaagctatgcat
gattttttagaaaaagaatattcgactgcaatcgtataccctgatagggaaaatatatat
caagcgtttgatttaacaccgtttgaaaatatcaaagttgttatattaggacaagacccg
tatcatggtccaaaccaagcacatggattagcattttcagtgcaacctaacgcaaaattc
cctccatctttacgtaatatgtataaagaattagcagatgatattggatgcgttagacaa
acaccgcatttacaagattgggcaagagaaggcgtcttgttattgaatacagttttaacc
gtaagacagggtgaagcaaattctcatcgtgatattggttgggaaacatttactgatgaa
attattaaagcagtgtctgattataaagaacatgttgtctttattttgtgggggaaacct
gcacagcaaaaaataaagcttatcgatacatctaaacattgtattataaaatcagtgcat
cctagtccactgtctgcatatagaggattctttggatcaaaaccgtattccaaagcgaat
gcctatttagagtcagtaggaaaatcaccaattaattggtgtgaaagtgaggcgtag

DBGET integrated database retrieval system