KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0585Help
Entry
SAHV_0585         CDS       T00588                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00435  Fe-coproporphyrin III decarboxylase [EC:1.11.1.-]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw00860  Porphyrin and chlorophyll metabolism
saw01100  Metabolic pathways
saw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAHV_0585
Enzymes [BR:saw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-  
     SAHV_0585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chlor_dismutase
Motif
Other DBs
NCBI-ProteinID: BAF77468
UniProt: A7WZ30
Position
complement(663114..663866)
Genome map
AA seq 250 aa AA seqDB search
MSQAAETLDGWYSLHLFYAVDWASLRIVPKDERDALVTEFQSFLENTATVRSSKSGDQAI
YNITGQKADLLLWFLRPEMKSLNHIENEFNKLRIADFLIPTYSYVSVIELSNYLAGKSDE
DPYENPHIKARLYPELPHSDYICFYPMNKRRNETYNWYMLTMEERQKLMYDHGMIGRKYA
GKIKQFITGSVGFDDFEWGVTLFSDDVLQFKKIVYEMRFDETTARYGEFGSFFVGHLINT
NEFDQFFAIS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcagccgaaacattagatggttggtatagtctacatttattttatgcagtt
gattgggcatcattacgtatagttccaaaggacgaacgcgatgcacttgtcactgaattt
caatcatttttagaaaatacagcaactgtaagatcatcaaaatctggtgatcaagctatt
tataatataactggtcaaaaagcagatttgttattatggttcttacgtcctgaaatgaag
tctttaaatcatattgaaaatgaatttaacaaattgcgcattgctgacttcctaatccct
acatattcatatgtatcagtcattgaattgagcaattatttagctggtaaatctgatgaa
gatccttatgagaaccctcatatcaaagcaagattatacccagaattaccacattctgat
tatatttgtttctatccaatgaacaaacgtcgtaatgaaacttataactggtacatgtta
actatggaagaacgccaaaaattaatgtatgaccatggtatgattggtagaaaatatgct
ggcaaaatcaaacaatttattactggttctgtagggtttgatgatttcgaatggggcgta
acattgttctcagatgacgtattacaattcaaaaaaattgtatacgaaatgcgctttgat
gaaacaacagcacgatacggtgaattcggtagtttctttgtaggacatcttattaacaca
aacgaattcgatcaattctttgcgatttcttaa

DBGET integrated database retrieval system