KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0599Help
Entry
SAHV_0599         CDS       T00588                                 

Definition
(GenBank) conserved hypothetical protein
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_red Flavodoxin_2 DUF1194 Flavodoxin_5
Motif
Other DBs
NCBI-ProteinID: BAF77482
Position
677688..678224
Genome map
AA seq 178 aa AA seqDB search
MITVLFGGSRPNGNTAQLTKFALQDLEYQWIDVTQHQFKPIRDVRHTAETITSYDDDYLP
ILDKILASDTIIFASPVYWYSISAPLKAFIEHWSETLQDKRYPNFKAQMAEKDFRVILVG
GDCPKIKAKPAITQMKYSLDFLGATLNGYIIGTAEKPGDIMKDNYALARATEWNSILQ
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgattactgttttgtttggtgggagtagaccaaacggtaatactgcacaattaacaaaa
ttcgctttgcaagatttagagtatcaatggattgacgtgacacaacatcagtttaaaccg
atacgtgacgtgagacatacagcagagactattacttcatatgacgatgactatttgccg
attctagataaaatattggctagtgatacaattatttttgcatcaccagtgtattggtat
agcatttcagcaccattgaaagcatttatcgaacattggtcagaaacattacaagataaa
cgatatcctaattttaaggcacaaatggccgaaaaggattttagagttattttagttggt
ggagattgtccaaaaataaaagcgaagccagcaattacgcaaatgaaatatagtttagac
tttttaggtgccactttaaatggttatattattggaactgctgaaaagcctggtgacatc
atgaaagacaactatgccttagcacgtgcaactgagtggaatagtatattgcaataa

DBGET integrated database retrieval system