KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0626Help
Entry
SAHV_0626         CDS       T00588                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K03316  monovalent cation:H+ antiporter, CPA1 family
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Brite
KEGG Orthology (KO) [BR:saw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SAHV_0626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger Trans_coact
Motif
Other DBs
NCBI-ProteinID: BAF77509
Position
701844..703886
Genome map
AA seq 680 aa AA seqDB search
MEIFETILIFIAVVILSSFVHTFIPKVPLAFIQIFLGMLLFITPIPVQFNFDSELFMVTM
IAPLLFVEGVNVSRVHLRKYIKPVMMMALGLVITTVIGVGLFIHWIWPDLPIGAAFAIAA
ILCPTDAVAVQAITKGKVLPKGAMTILEGESLLNDAAGIISFKIAVGVLVTGAFSLVDAV
QLFLIASIGGAVVGLLIGMALVRFRLTLMRRGYENINMFTIIQLLTPFVTYLIAELFHAS
GIIAAVVAGLVHGFERDRIMQVRTQLQMSYNHTWNILGYVLNGFVFSILGFLVPEVIIKI
IKTEPHNLIFLIGITIVVALAVYLFRFVWVYVLYPYFYLAISPFQKMMTKNDDDNPTTEK
PPKRSLYALIMTLCGVHGTISLAIALTLPYFLAGHHAFTYRNDLLFIASGMVIISLVVAQ
VLLPLLTKPAPKTVIGNMSFKVARIYILEQVIDYLNQKSTFETSFKYGNVIKEYHDKLAF
LKTVEKDDENSKELERLQKIAFNVETKTLESLVDEGQITNSVLENYMRYAERTQVYRQAS
LIRRMIVLLRGALLKRRVQTRVNSASSLSVTDNLMELNKINKLVHYNVVSRLSKETTKDN
TLEIGMVCDGYLMRIENLTPSNFFNSASEDTITKIKLNALREQRRILRELIDTDEVSEGT
ALKLREAINYDEMVIVDSMT
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
ttggaaatatttgaaacaattcttatatttatagctgttgtgatactaagttcgtttgtc
catactttcatacctaaagtacccctagcatttatacaaattttcttgggcatgttacta
tttattaccccaatccctgttcaatttaattttgattctgaattgtttatggtaacaatg
attgcgcctttgttatttgtagaaggtgttaatgtttctagagtccatttaaggaaatat
attaagccagtgatgatgatggcattaggattagtcattactactgtgataggtgtaggt
ttatttattcattggatttggccagatttacctattggagcagcatttgcaattgctgcc
attctttgtcctactgatgcagtagcagtgcaagcaatcactaaaggaaaggtcttgcca
aaaggagcaatgacaattcttgaaggtgagtcattattgaatgatgctgctggtattatt
tcatttaaaatagctgttggagtattagttacaggtgctttttcacttgttgatgctgtt
cagttgtttttaattgcatcaattggtggcgcagtggttggtttacttataggtatggca
ttagtaaggttccgattaacattgatgcgtcgaggatatgaaaacattaatatgtttaca
attattcaattgttaacaccatttgttacgtatttaattgctgaattgtttcacgcatca
ggaatcattgcagcagtagttgcaggacttgtacatggtttcgaacgtgacagaattatg
caagtacgtacacaactgcaaatgagttacaatcatacatggaatatactaggttatgtt
ttaaatggctttgttttttcaatattaggatttttagtacctgaagttattattaaaatt
atcaaaacagaaccgcacaatttaatctttttaataggcatcactattgttgttgcttta
gctgtctatctatttagatttgtttgggtttatgtcttatatccttatttttatttagcc
atcagtccattccaaaaaatgatgactaaaaatgatgatgataatccaacgactgagaaa
ccaccaaagcgaagtttatacgctttaattatgacgttatgtggtgtgcatggaacaatt
tctttagcaatcgcattaacgttaccttattttttagcagggcatcatgcttttacgtat
agaaacgacttattatttattgcatctggtatggttattattagtttggtagttgcgcaa
gtattattgccattattaacgaaacctgcacctaaaacagtaattggcaatatgtcgttt
aaagttgctagaatttatatattagaacaagttattgattatctaaatcaaaaatctact
ttcgaaacaagttttaaatatggtaacgtgattaaagaatatcatgataaattagcattt
ttaaaaactgtagagaaagatgatgaaaactctaaagaattagaacgtctacaaaaaatt
gcttttaatgtagaaacaaaaacattagagtctttagtagatgaaggacaaataacgaat
agtgtacttgaaaactatatgcgttatgctgaaagaacacaggtatatagacaagcatca
ttaataagaagaatgattgtattattacgaggtgctttattaaaacgaagagtacaaacg
agagtgaactccgcatcttcacttagtgttacggataacttaatggaattaaataaaatt
aataaattagtccattataatgtggttagtcgtttgtctaaggaaacaacaaaagataat
acacttgaaattggaatggtttgtgacggttatttaatgcgaattgaaaacttaacacca
tcaaatttcttcaactcagcaagtgaagatacgattactaaaattaaattaaatgcattg
agagaacaacgtcgcattttacgtgagttgattgatacagatgaagtatcagaaggtaca
gcgttaaaactaagagaagccatcaattatgatgaaatggttattgtagatagtatgacg
tag

DBGET integrated database retrieval system