KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0629Help
Entry
SAHV_0629         CDS       T00588                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K19976  manganese/zinc transport system permease protein
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw02010  ABC transporters
Module
saw_M00792  Manganese/zinc transport system
Brite
KEGG Orthology (KO) [BR:saw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SAHV_0629
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:saw02000]
    SAHV_0629
Transporters [BR:saw02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Manganese/zinc transporter [MD:M00792] [OT]
    SAHV_0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC-3 FecCD YccF DUF2407_C
Motif
Other DBs
NCBI-ProteinID: BAF77512
Position
complement(707359..708195)
Genome map
AA seq 278 aa AA seqDB search
MLEFVEHLFTYQFLNRALITSIIVGIVCGTVGSLIVLRGLSLMGDAMSHAVLPGVALSFL
FGIPMFVGALITGMIASIFIGYITSSSKTKPDAAIGISFTAFLASGIIIISLINTTTDLY
HILFGNLLAITNSAFLTTIVIGSIVLILIIIFYRPLMISTFDPTFSRMSGLNTTLLHYFV
MLLLSLVTVASIQTVGIILVVALLITPASTAFLISKKLYSMMIIASLISVISSIVGLYYS
YIYNIPSGATIVLCTFVIYIITLFFTKFTNRKKRGSLT
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgttagagtttgtcgaacatttatttacatatcaattcttgaatcgagcattgataact
tcaattattgtagggatagtttgtggtacagttggtagtttaattgtattacgtggtctt
tcattaatgggagatgcaatgagtcacgcagtattacctggtgttgccctatcattctta
tttggtattccaatgtttgtaggcgcacttataactggtatgatcgcaagtatttttatc
ggttatatcacatctagtagtaaaacgaaacctgacgccgctattggaattagttttacc
gctttcttagcttcggggattattattattagcttaataaacactacgacagatttgtac
catattctgtttggtaatttactggcaatcacaaatagtgcatttttaacaactattgtg
attggttcaatcgtccttattctaatcattattttctatcgtccattaatgatttctaca
ttcgatccaacgtttagtagaatgagtggtctaaatacgacgttattacattactttgtg
atgttgttactctcattagtaacagtagcaagtattcaaacggtaggtattattcttgta
gttgcattattaattacacctgcatctacagcatttttaattagtaaaaaactatactca
atgatgattatagcaagtttaataagtgtcataagttcaattgtcggactttattacagc
tatatttacaacattcctagtggtgcgacaatcgtactttgtacgtttgtaatttatatc
atcacattatttttcacaaaatttacgaatagaaagaaacgaggaagtttaacatga

DBGET integrated database retrieval system