KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0630Help
Entry
SAHV_0630         CDS       T00588                                 

Definition
(GenBank) hypothetical protein
  KO
K19973  manganese/zinc transport system ATP-binding protein [EC:3.6.3.35]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw02010  ABC transporters
Module
saw_M00792  Manganese/zinc transport system
Brite
KEGG Orthology (KO) [BR:saw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SAHV_0630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:saw02000]
    SAHV_0630
Enzymes [BR:saw01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.35  manganese-transporting ATPase
     SAHV_0630
Transporters [BR:saw02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Manganese/zinc transporter [MD:M00792] [OT]
    SAHV_0630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 ATPase_2 AAA_29 RsgA_GTPase MMR_HSR1 AAA_22 ArgK AAA_16 DUF815 AAA_PrkA RNA_helicase Dynamin_N AAA_35 AAA AAA_23 MobB KAP_NTPase AAA_14 AAA_26
Motif
Other DBs
NCBI-ProteinID: BAF77513
Position
complement(708189..708932)
Genome map
AA seq 247 aa AA seqDB search
MLETKDLNLFLGNKHVLKNISLSIPVRGEIIGIMGPNGAGKSSLIKSLIGEFNATGTKLL
YNKPIQQQLQHITYIPQKAHIDLDFPISVEQVILSGCYKEIGWFRRPNKSARDKLKQLLS
DLELESLRHRQISELSGGQLQRVLVARALMSESEVYFLDEPFVGIDFSSEKLIMTKIENL
KQQGKLILIIHHDLSKAKQYFDRIILLNQTLRYFGDSEEAMSVTRLNETFMSSTDCSDPS
QRSNITC
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
ttgttagaaacaaaagatttaaatctgtttttaggtaataagcatgtacttaaaaacatt
tccttatcgataccagtacgcggcgaaataattggtatcatgggcccgaatggtgctggt
aaatcttcccttatcaagtctttaattggtgaatttaatgctaccggtactaaattgtta
tataacaaacctatacaacaacaactgcaacatattacatatattccacaaaaagcacat
attgatttagattttcctataagtgtggaacaagtgattttatcaggttgctacaaagaa
attggatggtttagacgacctaataaatcagcaagggataaactcaaacagttattaagc
gatttagaattagaatctttacgtcatcgacaaatttcagaattaagtggtggacaatta
caacgtgtgctagtagcaagagcattgatgtccgaaagtgaagtttattttctagatgag
ccgtttgtcggaattgattttagtagcgaaaaattaatcatgacaaaaatcgagaactta
aaacaacaaggaaaacttattcttatcatccaccatgatctatcaaaagcaaagcaatac
tttgatcgcattattctattaaatcaaacattacgatactttggtgatagtgaagaggct
atgagtgtcactcgcttaaacgaaacatttatgagtagcactgactgtagtgaccctagt
caaaggagcaatataacatgttag

DBGET integrated database retrieval system