KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0634Help
Entry
SAHV_0634         CDS       T00588                                 

Gene name
tagH
Definition
(GenBank) teichoic acid translocation ATP-binding protein
  KO
K09693  teichoic acid transport system ATP-binding protein [EC:3.6.3.40]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw02010  ABC transporters
Module
saw_M00251  Teichoic acid transport system
Brite
KEGG Orthology (KO) [BR:saw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SAHV_0634 (tagH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:saw02000]
    SAHV_0634 (tagH)
Enzymes [BR:saw01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.40  teichoic-acid-transporting ATPase
     SAHV_0634 (tagH)
Transporters [BR:saw02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Teichoic acid transporter [MD:M00251]
    SAHV_0634 (tagH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ArgK AAA_21 RsgA_GTPase AAA_29
Motif
Other DBs
NCBI-ProteinID: BAF77517
Position
complement(711591..712385)
Genome map
AA seq 264 aa AA seqDB search
MNVSVNIKNVTKEYRIYRTNKERMKDALIPKHKNKTFFALDDISLKAYEGDVIGLVGING
SGKSTLSNIIGGSLSPTVGKVDRNGEVSVIAISAGLSGQLTGIENIEFKMLCMGFKRKEI
KAMTPKIIEFSELGEFIYQPVKKYSSGMRAKLGFSINITVNPDILVIDEALSVGDQTFAQ
KCLDKIYEFKEQNKTIFFVSHNLGQVRQFCTKIAWIEGGKLKDYGELDDVLPKYEAFLND
FKKKSKAEQKEFRNKLDEARFVIK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtttcggtaaacattaaaaatgtaacaaaagaatatcgtatttatcgtacaaat
aaagaacgtatgaaagatgcgctcattcccaaacataaaaacaaaacatttttcgcttta
gatgacattagtttaaaagcatatgaaggtgacgtcatagggcttgttggcatcaatggt
tccggcaaatcaacgttgagcaatatcattggcggttctttgtcgcctactgttggcaaa
gtggatcgtaatggtgaagtcagcgttatcgcaattagtgctggcttgagtggacaactt
acagggattgaaaatatcgaatttaaaatgttatgtatgggctttaagcgaaaagaaatt
aaagcgatgacacctaagattattgaatttagtgaacttggtgagtttatttatcaacca
gttaaaaagtattcaagtggtatgcgtgcaaaacttggtttttcaattaatatcacagtt
aatccagatatcttagtcattgacgaagctttatctgtaggtgaccaaacttttgcacaa
aaatgtttagataaaatttacgagtttaaagagcaaaacaaaaccatctttttcgttagt
cataacttaggccaagtgagacaattttgtactaagattgcttggattgaaggcggaaag
ttaaaagattacggtgaacttgatgatgtattacctaaatatgaagctttccttaacgat
tttaaaaagaaatccaaagccgaacaaaaagaatttagaaacaaactcgatgaggcccgc
ttcgttattaaataa

DBGET integrated database retrieval system