KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0668Help
Entry
SAHV_0668         CDS       T00588                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09145  uncharacterized protein
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Brite
KEGG Orthology (KO) [BR:saw00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SAHV_0668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF402 SAS-6_N ABC_transp_aux
Motif
Other DBs
NCBI-ProteinID: BAF77551
Position
748267..748911
Genome map
AA seq 214 aa AA seqDB search
MKVKYIDKRHWRRLIDREYTEVKVNNNRFKGIIGLVTMKKVRDPLEVTVVGQNIIVADDN
YKWLQILPEKKRYSITVMFDNKGNPLEYYFDINIKNITQKGNARTVDLCLDVLALPSGEY
ELVDEDDLMFALESEQITKKQFHEAYMIAHQIMAELENDFKGFQKKIMYCFNKINAKAQK
NHQKPQNKTNIEKSKQIKPKQYNQTKNHQQQKKN
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtaaagtatatagataaacgtcactggcgtcgcctaattgatagggaatacaca
gaggtaaaagttaataataataggtttaagggtattataggcttagtcacgatgaaaaag
gttcgtgatcctttagaggtgacggtagttggacaaaatatcattgtcgcagatgacaat
tataaatggttgcaaatactacctgaaaagaaacgttatagtataactgtaatgtttgat
aataaaggcaatccattagaatattattttgatataaatatcaaaaatataacgcaaaaa
ggtaatgcgcgtacagtagatttatgtttagatgttttagcattaccaagtggtgaatat
gagttggtagatgaagatgatttaatgtttgcattagaaagtgagcaaattacaaaaaag
caatttcatgaagcatatatgattgcacatcaaattatggcagagttagaaaatgatttt
aaaggattccaaaagaaaatcatgtactgctttaataaaattaatgcaaaggctcaaaaa
aatcatcaaaagccacaaaataaaactaatattgaaaaaagcaaacaaataaaacctaag
caatataatcaaactaaaaatcaccaacaacaaaagaaaaactaa

DBGET integrated database retrieval system