KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_1037Help
Entry
SAHV_1037         CDS       T00588                                 

Definition
(GenBank) hypothetical protein
  KO
K08680  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC:4.2.99.20]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw00130  Ubiquinone and other terpenoid-quinone biosynthesis
saw01100  Metabolic pathways
saw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SAHV_1037
Enzymes [BR:saw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     SAHV_1037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase Staphopain_pro Lipase_3 Ndr DUF2974 PGAP1 Esterase DLH Abhydrolase_2 DUF915 BAAT_C
Motif
Other DBs
NCBI-ProteinID: BAF77920
Structure
PDB: 

Position
1095891..1096694
Genome map
AA seq 267 aa AA seqDB search
MTHYKYYEANVETNQVLVLLHGFLSDSRTYYNHIDKYTDICHVITIDLPGHGEDQSSMDE
TWNFDYITTLLDRILDKYKDKSITLFGYSMGGRVALYYAINGHIPISNLILESTSPGIKE
EANQLERRLVDDARAKVLDIAGIELFVNDWEKLPLFQSQLELPVEIQHQIRLQRLSQSPQ
KMAKALRDYGTGQMPNLWPRLKEIKVPTLILAGEYDEKFVQIAKKMANLIPNSKCKLISA
TGHTIHVEDSDEFDTMILGFLKEEQND
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacacattataaatactatgaagcaaacgttgagaccaatcaagttttagtattactg
catggttttcttagcgacagtcgtacttattataatcacatcgataaatatactgatatc
tgtcatgtcatcactatagacttaccaggccatggcgaagatcagtcttcaatggatgaa
acgtggaattttgattatattacgacgttgttagaccgaattttagataaatataaagat
aaatcaataacattgtttggatattcaatgggtgggcgtgttgcattatattatgcaatt
aatggtcacatccctatatctaatttgatattagaaagtacgtcaccaggtattaaagaa
gaagcaaatcaattggaacgccgtcttgttgatgatgcacgtgctaaagtattagacata
gcaggtattgaattatttgttaatgattgggaaaagttgccattatttcaatcgcaacta
gaattaccagttgaaatacaacatcaaataagactacaacgattgtctcaatcgccacag
aaaatggccaaagcattaagagattatggtacaggtcaaatgccaaacttatggccgcgc
ctgaaagaaattaaagtaccaacattaatattagctggagaatatgatgaaaaatttgta
cagattgcgaaaaaaatggcaaatttaattcctaatagtaaatgtaaattaatttctgct
acaggtcatacaattcatgtggaagatagtgatgaatttgatacaatgatattaggattt
ttaaaggaggagcaaaatgactaa

DBGET integrated database retrieval system