KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_2529Help
Entry
SAHV_2529         CDS       T00588                                 

Gene name
mvaA
Definition
(GenBank) hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw00900  Terpenoid backbone biosynthesis
saw01110  Biosynthesis of secondary metabolites
saw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saw00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAHV_2529 (mvaA)
Enzymes [BR:saw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     SAHV_2529 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red UPF0180 Co_AT_N
Motif
Other DBs
NCBI-ProteinID: BAF79412
Position
complement(2689287..2690564)
Genome map
AA seq 425 aa AA seqDB search
MQSLDKNFRHLSRQQKLQQLVDKQWLSEDQFDILLNHPLIDEEVANSLIENVIAQGALPV
GLLPNIIVDDKAYVVPMMVEEPSVVAAASYGAKLVNQTGGFKTVSSERIMIGQIVFDGVD
DTEKLSADIKALEKQIHKIADEAYPSIKARGGGYQRIAIDTFPEQQLLSLKVFVDTKDAM
GANMLNTILEAITAFLKNESPQSDILMSILSNHATASVVKVQGEIDVKDLARGERTGEEV
AKRMERASVLAQVDIHRAATHNKGVMNGIHAVVLATGNDTRGAEASAHAYASRDGQYRGI
ATWRYDQKRQRLIGTIEVPMTLAIVGGGTKVLPIAKASLELLNVDSAQELGHVVAAVGLA
QNFAACRALVSEGIQQGHMSLQYKSLAIVVGAKGDEIAQVAEALKQEPRANTQVAERILQ
EIRQQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtttagataagaatttccgacatttatctcgtcaacaaaagttacaacaattg
gtagataagcaatggttatcagaagatcaattcgacattttattgaatcatccattaatt
gatgaggaagtagcaaatagtttaattgaaaatgtcatcgcgcaaggtgcattacccgtt
ggattattaccgaatatcattgtggacgataaggcatatgttgtacctatgatggtggaa
gagccttcagttgtcgctgcagctagttatggtgcaaagctagtgaatcagactggcgga
tttaaaacggtatcttctgaacgtattatgataggtcaaatcgtctttgatggcgttgac
gatactgaaaaattatcagcagacattaaagctttagaaaagcaaattcataaaattgcg
gatgaggcatatccttctattaaagcgcgtggtggtggttaccaacgtatagctattgat
acatttcctgagcaacagttactatctttaaaagtatttgttgatacgaaagatgctatg
ggcgctaatatgcttaatacgattttagaggccataactgcatttttaaaaaatgaatct
ccacaaagcgacattttaatgagtattttatccaatcatgcaacagcgtccgttgttaaa
gttcaaggcgaaattgacgttaaagatttagcaaggggcgagagaactggagaagaggtt
gccaaacgaatggaacgtgcttctgtattggcacaagttgatattcatcgtgctgcaaca
cataataaaggtgttatgaatggcatacatgccgttgttttagcaacaggaaatgatacg
cgtggtgcagaagcaagtgcgcatgcatacgcgagtcgtgacggacagtatcgtggtatt
gcaacatggagatacgatcaaaaacgtcaacgtttaattggtacaatagaagtgcctatg
acattggcaatcgttggcggtggtacaaaagtattaccaattgctaaagcttctttagaa
ttgctaaatgtagattcagcacaagaattaggtcatgtagttgctgccgttggtttagca
cagaactttgcagcatgtcgcgcgctcgtttccgaaggtatccagcaaggccatatgagc
ttgcaatataaatctttagctattgttgtaggtgcaaaaggtgatgaaattgcgcaagta
gctgaagcattgaagcaagaaccccgtgcgaatacacaagtagctgaacgcattttacaa
gaaattagacaacaatag

DBGET integrated database retrieval system