KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_0180
Entry
USA300HOU_0180    CDS       T00629                                 

Definition
(GenBank) hypothetical membrane protein
  KO
K09790  uncharacterized protein
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
Brite
KEGG Orthology (KO) [BR:sax00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    USA300HOU_0180
SSDB
Motif
Pfam: DUF454 Glyoxalase_2
Other DBs
NCBI-ProteinID: ABX28212
Position
complement(191022..191405)
AA seq 127 aa
MRLILIVIGLIFTALGIAGAVLPLLPTTPFLLVAVFCFARSSDRFYNWLINQKIYKEYVE
NFYLHRGYTLQQKIKILISLYIVIGFSIYMVDVLAVRVGLIIMVIIQTAVLFTFVKTLPK
SNHKIEE
NT seq 384 nt   +upstreamnt  +downstreamnt
atgcgacttattttaatcgtcattggcttaatatttacagcgcttggtattgcaggtgcc
gtattacctttactgccaacgaccccttttttactcgtagcagttttttgttttgctcga
agttcagatcgcttttacaattggcttattaatcaaaaaatttataaagaatatgtagaa
aacttttatttacatcgaggctacacgctacaacagaaaattaaaattttaattagctta
tacattgtaataggtttttcaatttatatggtggatgttcttgcagtccgtgtaggatta
atcataatggttatcatacaaaccgctgtactctttacatttgtaaaaacattacccaaa
tcaaatcataaaatagaggagtga

DBGET integrated database retrieval system