KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_0534
Entry
USA300HOU_0534    CDS       T00629                                 

Gene name
rplL1
Definition
(GenBank) ribosomal protein L7/L12
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
Pathway
sax03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sax00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    USA300HOU_0534 (rplL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sax03011]
    USA300HOU_0534 (rplL1)
Ribosome [BR:sax03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    USA300HOU_0534 (rplL1)
  Bacteria
    USA300HOU_0534 (rplL1)
SSDB
Motif
Pfam: Ribosomal_L12 Ribosomal_L12_N Bac_DNA_binding DUF2267 CwsA PP2C_C
Other DBs
NCBI-ProteinID: ABX28560
UniProt: A8YZN8
Position
584731..585099
AA seq 122 aa
MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVEL
TSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVE
LK
NT seq 369 nt   +upstreamnt  +downstreamnt
atggctaatcatgaacaaatcattgaagcgattaaagaaatgtcagtattagaattaaac
gacttagtaaaagcaattgaagaagaatttggtgtaactgcagctgctccagtagcagta
gcaggtgcagctggtggcgctgacgctgcagcagaaaaaactgaatttgacgttgagtta
acttcagctggttcatctaaaatcaaagttgttaaagctgttaaagaagcaactggttta
ggattaaaagatgctaaagaattagtagacggagctcctaaagtaatcaaagaagcttta
cctaaagaagaagctgaaaaacttaaagaacaattagaagaagttggagctactgtagaa
ttaaaataa

DBGET integrated database retrieval system