KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_0691
Entry
USA300HOU_0691    CDS       T00629                                 

Definition
(GenBank) hypothetical protein
  KO
K09705  uncharacterized protein
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
Brite
KEGG Orthology (KO) [BR:sax00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    USA300HOU_0691
SSDB
Motif
Pfam: Cupin_5
Other DBs
NCBI-ProteinID: ABX28712
Position
746420..746893
AA seq 157 aa
MKSAEQWIDELQLESHPEGGFYRETIREVLKDGRRAPFSSIYFLLTDDNISHFHRIDADE
VWYYHAGDSLTIHMINPDGEYTTATLGTDIQNGDVLQYVVPKGTIFASSIEISNTFSLVG
CMCQPAFEFKQFELFKQSELITQYPHLKSVIEKYALK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgaaatcagcagaacaatggattgatgaattgcaacttgaatcacatcctgaaggtggt
ttctatagagagacaattcgagaagtattgaaagatggacgcagagcgccgtttagtagt
atttattttttacttacagatgacaatatttcgcattttcatcgaattgatgctgatgaa
gtatggtactatcatgctggcgattctctaacaattcatatgataaatccggatggggaa
tatacgactgcaacattgggtactgatatccaaaatggagatgtattgcaatatgtagtg
cctaaaggaacaatttttgcttcttcaatcgaaatatcaaatacttttagtttagtaggt
tgtatgtgtcaaccggcatttgagtttaagcagtttgaattgtttaagcaatctgaatta
attacgcaatatccgcatcttaaatcagtaatcgaaaaatatgctttaaaataa

DBGET integrated database retrieval system