KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_0790
Entry
USA300HOU_0790    CDS       T00629                                 
Name
(GenBank) possible acetyltransferase
  KO
K24872  heptaprenylglycerol acetyltransferase [EC:2.3.1.-]
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
Pathway
sax00564  Glycerophospholipid metabolism
sax01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sax00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    USA300HOU_0790
Enzymes [BR:sax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-
     USA300HOU_0790
SSDB
Motif
Pfam: Hexapep_2 Hexapep
Other DBs
NCBI-ProteinID: ABX28811
Position
845061..845546
AA seq 161 aa
MRKFLSKTHHHTNPLWRVYRLVKFSKVFKNVIIIEFSKFIPSMVLKRHIYKQLLNINIGN
QSSIAYKVMLDIFYPELITIGSNSVIGYNVTILTHEALVDEFRYGPVTIGSNTLIGANAT
ILPGITIGDNVKVAAGTVVSKDIPDNGFAYGNPMYIKMIRR
NT seq 486 nt   +upstreamnt  +downstreamnt
ttgaggaaatttttatcaaaaacacatcatcatacaaaccctttatggcgtgtataccgt
cttgttaaattttcgaaagtttttaagaatgtaattatcattgaattttcgaaatttatt
ccaagtatggtactgaaaagacatatatataaacaacttttaaatattaatatcggtaat
caatcgtcgatagcttataaagtaatgttagatattttttacccagaactgattacgatt
ggtagtaacagtgttattggttacaatgtaacaattttgacgcatgaagcattagttgat
gaatttcgttatggaccagtgacgataggatctaacactttgattggtgcaaatgctacc
attttacccggtataacgattggtgacaatgtaaaagttgcagctggtacggttgtttca
aaagatataccggataatggatttgcatatggcaaccctatgtatataaaaatgattagg
aggtga

DBGET integrated database retrieval system