KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_0991
Entry
USA300HOU_0991    CDS       T00629                                 
Symbol
menD
Name
(GenBank) 2-oxoglutarate decarboxylase
  KO
K02551  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [EC:2.2.1.9]
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
Pathway
sax00130  Ubiquinone and other terpenoid-quinone biosynthesis
sax01100  Metabolic pathways
sax01110  Biosynthesis of secondary metabolites
sax01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:sax00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    USA300HOU_0991 (menD)
Enzymes [BR:sax01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     USA300HOU_0991 (menD)
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M_2 TPP_enzyme_C adh_short_C2
Other DBs
NCBI-ProteinID: ABX29011
UniProt: A8Z0D7
Position
1048343..1050016
AA seq 557 aa
MGNHKAALTKQVFTFASELYAYGVREVVISPGSRSTPLALAFEAHPNIKTWIHPDERSAA
FFAVGLIKGSERPVAILCTSGTAAANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQA
INQVNMFNNYVSYEFDMPIADDSKETIDAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLT
PDLNATELLTSEMKILPHYQKSIDASALRHILNKKKGLIIVGDMQHQEVDQILTYSTIYD
LPILADPLSHLRKFDHPNVICTYDLLFRSGLDLNVDFVIRVGKPVISKKLNQWLKKTDAF
QILVQNNDKIDVFPIAPDISYEISANDFFRSLMEDTTVNRVSWLEKWQCLEKKGRKEIKC
YLEQATDESAFVGELIKKTSEKDALFISNSMPIRDVDNLLLNKNIDVYANRGANGIDGIV
STALGMAVHKRITLLIGDLSFYHDMNGLLMSKLNNIQMNIVLLNNDGGGIFSYLPQKESA
TDYFERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNATLLSETSTIYELITNREDNFK
QHQILYQKLSEMIHDTL
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgggaaatcataaagcagctttaacgaagcaagtttttacatttgcatctgagttatat
gcgtacggcgtaagggaagtagttatcagtccgggatcacgctcaacgccacttgcactt
gcatttgaagcacatccaaatattaaaacatggatacaccccgatgagcgaagtgcagcg
ttttttgcagttgggttaattaaaggcagtgaaagacctgtcgctatattatgtacgtca
ggtacagcagcagcgaattatacgcctgcaattgctgaaagccaaattagtagaattcct
ttaatcgttttaacaagtgaccgtccgcatgaattaagaagtgtaggcgcaccacaagcg
attaatcaagtaaatatgtttaataattatgtaagttatgagttcgatatgcctattgcg
gatgatagtaaagagaccattgatgcaatttactatcaaatgcaaattgctagtcaatat
ttatatggaccacataaagggccaattcattttaacttgccatttagagatccgttaaca
cctgatttgaatgcaacagaattgttaacttctgagatgaagattttaccgcactatcaa
aaaagtatagatgcatcggcattaagacacattttaaataagaaaaaaggtttaattatt
gtaggggatatgcagcaccaagaagttgatcaaatactaacgtattcaacgatatatgat
ttgcctattttagctgatcctttaagtcatttaagaaaatttgatcatccgaatgttatc
tgtacatatgatttgctgtttagaagcggcttagacttaaatgtggatttcgtaattcgt
gttgggaaaccagtgatttctaaaaagttaaatcaatggttaaagaaaactgatgcattt
caaatattagtgcaaaacaatgataagattgatgtctttccgatagcgccagatatttca
tatgagatttctgcgaatgatttctttaggtcattaatggaagacacgacagttaatcgc
gtaagttggttagaaaaatggcaatgcttagagaaaaaagggcgtaaagaaattaaatgt
tatttggaacaagctacagatgagagtgcattcgttggtgaattgattaagaaaacatct
gaaaaagatgcattatttattagtaatagtatgcctatcagagatgtagataacttgtta
ttgaataaaaatatagatgtctatgcgaatcgtggtgcgaatggtattgatggtatcgtt
tcaactgcactgggtatggctgtgcataaacgaataacattattgataggtgatttatca
ttttatcatgatatgaatggactattaatgtcaaaattaaataatattcagatgaatatt
gtattattgaacaacgatggtggcggtattttttcatatttaccacaaaaagaaagtgca
actgactattttgaacggttgtttggcacaccgacgggattggatttcgagtatacagct
aagttatatcaattcgattttaaacgttttaacagtgtttcagaatttaaaaatgccaca
ttgttatctgaaacttcgacgatttatgaattgataacgaatcgcgaagataactttaaa
cagcatcaaattttataccagaaattgagtgaaatgattcatgacacattataa

DBGET integrated database retrieval system