KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_0994
Entry
USA300HOU_0994    CDS       T00629                                 

Symbol
sspC
Name
(GenBank) I57 family staphostatin B
  KO
K23597  staphostatin B
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
Brite
KEGG Orthology (KO) [BR:sax00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sax01002]
    USA300HOU_0994 (sspC)
Peptidases and inhibitors [BR:sax01002]
 Peptidase inhibitors
  Family I57: staphostatin B family
   USA300HOU_0994 (sspC)
SSDB
Motif
Pfam: Staphostatin_B Staphostatin_A
Other DBs
NCBI-ProteinID: ABX29014
Structure
PDB: 
1NYC 1QWX 1PXV 1Y4H

Position
complement(1051859..1052188)
AA seq 109 aa
MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDT
AHQRIKFSSIDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV
NT seq 330 nt   +upstreamnt  +downstreamnt
atgtatcaactacaatttataaatttagtttacgacacaaccaaactcacacatctagaa
caaaccaatatcaatttattcattggtaattggagtaatcatcaattacaaaaatcaatt
tgtatacgtcatggcgatgatacaagtcacaatcaatatcatattctttttatagatacg
gcacatcaacgcattaaattttcatctattgataatgaagaaatcatttatattcttgat
tatgatgatacacagcatatcctcatgcaaacgtcatccaaacaaggtattggcacttcg
cgaccaatcgtttatgagcgcttagtataa

DBGET integrated database retrieval system