KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_1040
Entry
USA300HOU_1040    CDS       T00629                                 

Name
(GenBank) hypothetical protein
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
SSDB
Motif
Pfam: UPF0223 Tk-SP_N-pro
Other DBs
NCBI-ProteinID: ABX29060
UniProt: A8Z1N7
Position
1107533..1107808
AA seq 91 aa
MEYEYPIDLDWSNEEMISVINFFNHVEKYYESGVTAGDFMGAYKRFKEIVPAKAEEKQIF
NTFEKSSGYNSYKAVQDVKTHSEEQRVTAKK
NT seq 276 nt   +upstreamnt  +downstreamnt
atggaatatgagtatccaattgatttagactggagtaatgaagagatgatttcagtgata
aatttctttaatcatgtagagaagtattatgaatccggcgtgacggcaggcgactttatg
ggtgcatataaaagatttaaagaaattgtgcctgctaaagcagaggaaaaacaaattttt
aatactttcgaaaaaagtagtggctataatagttacaaagcagttcaagatgtaaaaact
cactctgaagaacaaagagtaacagctaaaaaataa

DBGET integrated database retrieval system