KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_1103
Entry
USA300HOU_1103    CDS       T00629                                 

Name
(GenBank) exotoxin
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
SSDB
Motif
Pfam: SSL_OB Stap_Strp_tox_C
Other DBs
NCBI-ProteinID: ABX29120
Position
complement(1172718..1173434)
AA seq 238 aa
MSKNITKNIILTTTLLLLGTVLPQNQKPVFSFYSEAKAYSIGQDETNINELIKYYTQPHF
SFSNKWLYQYDNGNIYVELKRYSWSAHISLWGAESWGNINQLKDRYVDVFGLKDKDTDQL
WWSYRETFTGGVTPAAKPSDKTYNLFVQYKDKLQTIIGAHKIYQGNKPVLTLKEIDFRAR
EALIKNKILYNENRNKGKLKITGGGNNYTIDLSKRLHSDLANVYVKNPNKITVDVLFD
NT seq 717 nt   +upstreamnt  +downstreamnt
atgagtaagaacatcacgaaaaatataattttaacgacaacattattactattaggtact
gtattacctcaaaatcaaaaaccagtatttagtttttactctgaagctaaagcttatagc
attggtcaagatgaaactaacatcaatgaattaattaaatattacacacagcctcatttt
tcattttcaaataaatggctatatcaatatgataatggaaacatttatgttgaacttaag
agatattcatggtcagcacatatatctttatggggcgctgaaagttggggaaatattaat
cagttaaaagatcgttacgtagatgtgtttggactaaaagacaaagatactgatcagtta
tggtggtcttatagagagacatttacaggtggcgttacaccagccgcaaaaccttctgat
aaaacttataatctttttgtgcaatacaaagataaactacaaacgattattggtgcgcat
aaaatataccaaggcaataaaccagtattaacattgaaagaaatcgatttccgtgcacga
gaagcgttaataaaaaataaaatattatataacgaaaatcgtaataaaggtaagcttaag
atcaccggtggcggtaataactacactattgatttaagcaaaagattacattcagatcta
gcaaatgtttatgttaaaaatcctaataaaataactgttgacgtcctctttgattag

DBGET integrated database retrieval system