KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_1428
Entry
USA300HOU_1428    CDS       T00629                                 

Name
(GenBank) lipoprotein
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
SSDB
Motif
Pfam: DUF1672 tRNA-synt_1c DUF6491
Other DBs
NCBI-ProteinID: ABX29438
Position
complement(1558675..1559592)
AA seq 305 aa
MFKRTKLILIATLLLSGCSTTNNESNKETKSVPEEMEASKYVGQGFQPPAEKDVVEFAKK
HKDKIAKRGEQFFMDNFGLKVKATNVVGSGKGVEVFVHCDDHDIVFNASIPFDKSIIESD
SSLRSEDKGDDMSTLVGTVLSGFEYRTQKEKYDNLYKFFKDNEEKYQYTGFTKEAINKTQ
NVGYKNEYFYITYSSRSLKEYRKYYEPLIHKNDKEFKEGMEQARKEVNYAANTDTVTTLF
STKENFTKDNTVDDVIELSDKLYNFKNKPEKSTITIQIGKPTINTKKAFYDDNDPIEYGV
YRKDE
NT seq 918 nt   +upstreamnt  +downstreamnt
atgtttaaaagaactaaactaatcttaatagcaacattactgctatcaggatgttcaact
accaataacgaatctaataaagaaacaaaatcagtgccagaagaaatggaagcttcaaaa
tatgtaggtcaaggcttccaaccacctgcagaaaaagatgtggttgaatttgcgaaaaag
cataaagataaaattgccaaacgaggcgaacaattttttatggataatttcggtctaaaa
gttaaagctaccaatgttgtaggtagtggaaaaggcgtagaagtattcgtgcattgtgat
gaccacgatatcgtatttaatgcgagtattccatttgataaatcaataattgagagtgat
agctcattaagaagtgaggacaaaggcgatgatatgagtactttagttggtacagtgttg
agtggctttgaatatcgaacacaaaaagaaaagtatgacaatttatataaatttttcaaa
gataatgaagagaaataccaatatacaggctttacaaaagaagcaataaacaagacgcaa
aatgtcggatataaaaatgaatatttttatatcacttactcgtcaagaagcttaaaagaa
tatcgtaagtattacgaaccattgattcataaaaatgataaagaatttaaagaaggaatg
gaacaagccagaaaagaagtgaattacgctgctaatacagatacagtaacaacattgttt
agtacaaaggaaaattttactaaagacaatacagttgatgatgtaattgaactgagtgat
aaactatataattttaaaaataagccagaaaaatctacaattacaattcaaataggaaag
cctactattaatactaaaaaagccttttatgatgataatgatccaatagaatatggagtg
tatcgtaaagatgaataa

DBGET integrated database retrieval system