KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_1433
Entry
USA300HOU_1433    CDS       T00629                                 

Definition
(GenBank) holin
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
Motif
Pfam: Holin_SPP1 Turandot DUF3783
Other DBs
NCBI-ProteinID: ABX29442
Position
complement(1563889..1564191)
AA seq 100 aa
MDAKVITRYIVLILALVNQFLANKGISPIPVDEESVSSIILTVVALYTTYKDNPTSQEGK
WANQKLKKYKAESKYRKATGQAPIKEVMTPTNMNDTNDLG
NT seq 303 nt   +upstreamnt  +downstreamnt
atggatgcaaaagtaataacaagatacatcgtattgatcttagcattagtaaatcaattc
ttagcgaataaaggtataagtccgataccagtagatgaagaaagtgtttcatcgattatc
ttaacagttgttgctttatatactacatataaagataatccaacatctcaagaagggaaa
tgggcgaatcaaaaattaaagaaatataaagctgaaagtaaatatagaaaagcaacaggg
caagcgccaattaaagaagtaatgacacctacgaatatgaacgacacaaatgatttaggg
tag

DBGET integrated database retrieval system