KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_1625
Entry
USA300HOU_1625    CDS       T00629                                 

Definition
(GenBank) hypothetical protein
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
SSDB
Motif
Pfam: CsbD TBCA Etd1 MT0933_antitox DUF6353
Other DBs
NCBI-ProteinID: ABX29632
Position
complement(1733237..1733419)
AA seq 60 aa
MADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKVIGKAKEVVENAKNKITDAIDKLKK
NT seq 183 nt   +upstreamnt  +downstreamnt
atggcagacgaaagtaagttcgatcaatttaaaggaaatgttaaagaaacagtaggtaac
gttactgataacaaagaattagaaaaagaaggtcagcaagataaagtgattggtaaagca
aaagaagttgttgaaaatgctaaaaacaaaataactgatgcaattgataaacttaaaaaa
taa

DBGET integrated database retrieval system