KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_1812
Entry
USA300HOU_1812    CDS       T00629                                 

Symbol
epiD
Name
(GenBank) lantibiotic epidermin biosynthesis protein EpiD
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
SSDB
Motif
Pfam: Flavoprotein HNH_2
Other DBs
NCBI-ProteinID: ABX29815
Structure
PDB: 
3QJG

Position
complement(1949974..1950492)
AA seq 172 aa
MGENVLICLCGSVNSINISHYIIELKSKFDEVNVIASTNGRKFINGEILKQFCDNYYDEF
EDPFLNHVDIANKHDKIIILPATSNTINKIANGICDNLLLTICHTAFEKLSIFPNMNLRM
WENPVTQNNIRLLKDYGVSIYPANISESYELASKTFKKNVVAPEPYKVLEFI
NT seq 519 nt   +upstreamnt  +downstreamnt
atgggagaaaatgtattgatttgtttgtgtggctcagttaatagtatcaatattagccac
tatattattgaattaaaatcaaaatttgatgaagtaaatgtaatcgcgtcaacaaacggt
agaaagtttattaatggtgaaatattaaagcaattttgcgataactattatgacgaattt
gaagacccttttttaaatcatgtagatatagcaaataaacatgacaagattattatttta
cctgcgacttctaatacgattaataaaattgcaaatggtatatgtgacaatttattatta
actatttgtcatacagcttttgaaaaactttctatatttccaaatatgaatttacgaatg
tgggaaaatccagttactcaaaataatattcgattattaaaagattatggtgtatcaata
tatccagcaaatatttcagaaagttatgaattagcgtcaaaaacatttaaaaagaatgtt
gtcgcacctgaaccatataaagttctggaattcatttga

DBGET integrated database retrieval system