KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_1897
Entry
USA300HOU_1897    CDS       T00629                                 

Definition
(GenBank) hypothetical protein
  KO
K07029  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
Pathway
sax00561  Glycerolipid metabolism
sax00564  Glycerophospholipid metabolism
sax01100  Metabolic pathways
sax01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sax00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    USA300HOU_1897
   00564 Glycerophospholipid metabolism
    USA300HOU_1897
Enzymes [BR:sax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     USA300HOU_1897
SSDB
Motif
Pfam: DAGK_cat YegS_C NAD_kinase
Other DBs
NCBI-ProteinID: ABX29900
UniProt: A8Z2R1
Structure
PDB: 
2QV7 2QVL

Position
complement(2039970..2040917)
AA seq 315 aa
MRKRARIIYNPTSGKELFKRELPDALIKLEKAGYETSAYATEKIGDATLEAERAMHENYD
VLIAAGGDGTLNEVVNGIAEKPNRPKLGVIPMGTVNDFGRALHIPNDIMGALDVIIEGHS
TKVDIGKMNNRYFINLAAGGQLTQVSYETPSKLKSIVGPFAYYIKGFEMLPQMKAVDLRI
EYDGNVFQGEALLFFLGLTNSMAGFEKLVPDAKLDDGYFTLIIVEKSNLAELGHIMTLAS
RGEHTKHPKVIYEKAKAINISSFTDLQLNVDGEYGGKLPANFLNLERHIDVFAPNDIVNE
ELINNDHVDDNLIEE
NT seq 948 nt   +upstreamnt  +downstreamnt
atgaggaaacgtgctagaatcatttataacccgacatcaggtaaagagctatttaaaaga
gaattacctgatgccttaataaaattagaaaaagcgggatatgaaacgagtgcatatgca
accgagaaaataggtgatgccacacttgaagcagaaagagctatgcatgaaaattatgat
gtattaatcgctgcaggtggtgatggaacattaaatgaagtagttaatggtatcgcagaa
aagcctaatcgtcctaagctaggtgtcattcctatgggtactgttaatgactttggacgt
gcattgcatatacctaatgacatcatgggggcacttgatgtcatcattgaaggtcattct
actaaagtagatattggtaaaatgaataatcgatactttattaatttagctgcaggcgga
caattgacgcaagtctcttatgaaacaccgagtaaattgaaatctattgttggtccattt
gcttattacatcaaaggtttcgaaatgttacctcaaatgaaagctgtagatttaagaatt
gaatatgatggtaatgttttccaaggagaagcattattattctttttaggtttaacaaat
tcaatggcaggatttgaaaaattagtgccggacgctaagttagatgacggctattttacg
ttaattatagttgaaaaatcaaaccttgcagaacttggtcatattatgactttagcttca
agaggagaacatactaagcatcctaaagttatttatgaaaaagcaaaggcaattaatatt
tcatcattcacagacttacaactaaatgtagatggagaatatggtggtaaattaccagcg
aatttcttaaatctagaacgtcatatagatgtctttgcacctaatgatattgtaaatgaa
gagttaataaataatgatcatgttgatgacaatttaatcgaagaataa

DBGET integrated database retrieval system