KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_2155
Entry
USA300HOU_2155    CDS       T00629                                 

Name
(GenBank) transposase
  KO
K07485  transposase
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
Brite
KEGG Orthology (KO) [BR:sax00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    USA300HOU_2155
SSDB
Motif
Pfam: DDE_Tnp_ISL3 zf-ISL3 HTH_Tnp_ISL3 CxC3
Other DBs
NCBI-ProteinID: ABX30150
Position
2290812..2292014
AA seq 400 aa
MCNDTLELLRIKDENIKYINQEIDVIIKGKKATVVNAVLTYKPSACYCCGVKNEGQIHKH
GKRVSRITLLKTQGYNTYLNLAKQRFKCLECNGTFTAKTSIVDESCFISRCVTQKVIEEA
TKVKTEIDTAEDNCISPSTVSRIRTKAANSLRIKPFNCLPEHIAMDEFKSVKNVTGSMSF
IFIDNDTHDVIDILENRTTRFLRAYFERFDLKNRQQVKTVTIDMYEPYVRLFRDLFPNAA
IIFDRFHIVQHLNRELNKYRVQVMNEYRNKKGPDYTIFKNNWKVLLMDTSKTIFSKYRWN
KSFKAYKRSSDIVEFMLSKDDILRHSYELVQGLRKDLRLCNWPKFINRLNSVSKKSVSKG
VWKVVKYYRKHQRMLRNTIYYPAFNNGAIEGINNKIKLIK
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgtgtaatgataccttagaattactaagaataaaagatgaaaatataaaatatataaac
caagaaattgacgtcattatcaaaggaaaaaaagcaacagtggttaatgctgtactaacg
tataagccttcggcctgttattgttgtggagttaaaaatgaaggacaaattcataaacat
ggtaagcgtgtttctcgtattactttacttaaaactcaagggtataacacatacctcaac
ttagctaaacaacgttttaaatgcttagaatgcaatggcacttttactgctaaaacgtca
attgttgatgagtcgtgttttatctcaagatgtgttactcaaaaagttatagaagaagct
actaaagttaaaacagagattgatactgcagaagataactgtatctctccatctactgta
agtcgtattagaactaaagcggctaattcattacgaattaaaccctttaattgtttgcca
gaacacatcgctatggatgaatttaaaagcgttaaaaatgtaactggatcaatgagtttc
atttttatagataatgatactcatgatgttatagatattttagaaaatagaactacaaga
ttcttgcgtgcctatttcgagcgattcgatttaaaaaatcgacaacaagttaagacggtt
actattgacatgtatgaaccctatgtccgattatttcgcgacctatttcctaatgcagct
attatttttgacagattccatatcgttcaacatttaaatagagaacttaataagtatcgt
gtacaagttatgaatgaataccgtaataaaaaaggacctgattatacaatttttaagaat
aactggaaagtcctattgatggatactagtaaaaccatatttagtaaatacagatggaat
aaatcttttaaggcttataaacgctcatctgacattgtagaattcatgctttcaaaagac
gatatactacgacactcctacgaacttgtccaaggattacgaaaagacctaaggttatgt
aattggcctaaatttattaatcgtttaaattcagttagtaaaaagtctgtgagtaagggt
gtatggaaagtggttaaatattatagaaaacatcaaaggatgttaagaaatacaatttat
tacccagcatttaataatggtgctatagaaggaattaataataagataaaattaatcaag
tga

DBGET integrated database retrieval system