KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_2200
Entry
USA300HOU_2200    CDS       T00629                                 

Name
(GenBank) hypothetical protein
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
SSDB
Motif
Pfam: MAP
Other DBs
NCBI-ProteinID: ABX30193
Structure
PDB: 
1YN4

Position
2342899..2343324
AA seq 141 aa
MKLKSFVTATLALGLLSTVGAALPSHEASADSNNGYKEMTVDGYHTVPYTISVDGITALH
RTYFIFPENKNVLYQEIDSKVKNELASQRGVTTEKINNAQTATYTLTLNDGNKKVVNLKK
NDDAKNSIDPSTIKQIQIVVK
NT seq 426 nt   +upstreamnt  +downstreamnt
atgaaactaaaatcatttgttactgccactttagcattgggattattatcaacggtcgga
gctgcattaccgagtcacgaagcatctgcagatagtaataacggctataaagaaatgact
gtggatggttatcacactgttccttacacaatttcagtagatggtattactgcattacat
cgaacttactttatcttcccagaaaataaaaatgttctttatcaagaaattgacagtaaa
gtaaaaaatgaattagcttctcaacgtggtgttacaacagaaaaaattaataatgcccaa
acagcaacttatacgcttactttgaatgatggtaataaaaaagtagtgaatctaaagaaa
aatgacgacgctaaaaattcaattgatccaagtacaatcaaacagatacaaattgtagtt
aaataa

DBGET integrated database retrieval system