KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_2329
Entry
USA300HOU_2329    CDS       T00629                                 
Name
(GenBank) hypothetical protein
  KO
K07107  acyl-CoA thioester hydrolase [EC:3.1.2.-]
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
Brite
KEGG Orthology (KO) [BR:sax00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    USA300HOU_2329
Enzymes [BR:sax01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-
     USA300HOU_2329
SSDB
Motif
Pfam: 4HBT_2 4HBT
Other DBs
NCBI-ProteinID: ABX30321
Position
2466876..2467367
AA seq 163 aa
MVIIKQLFTHTQTVTSEFIDHNNHMHDANYNIIFSDVVNRFNYSHGLSLKERENLAYTLF
TLEEHTTYLSELSLGDVFTVTLYIYDYDYKRLHLFLTLTKEDGTLASTNEVMMMGINQHT
RRSDAFPESFSTQIAHYYKNQSTITWPEQLGHKIAIPHKGALK
NT seq 492 nt   +upstreamnt  +downstreamnt
atggttattatcaaacaactttttacacatactcaaaccgtaacatctgaattcattgac
cataacaatcatatgcatgatgcaaattataatatcatttttagtgacgtcgtgaatcgt
tttaattacagccacggtctttctttaaaagaacgcgaaaatttagcatatacgctattt
acactagaagaacatacgacatacctctcagaattgtctcttggcgatgtatttactgtt
actttatatatttatgattacgattataagcggttgcatttatttttaacattaactaaa
gaagatggtacactagcatcaacaaatgaagtaatgatgatgggaattaatcagcacaca
cgtcgttctgatgcttttcctgaatcattttcaacacaaatagcacactattataaaaat
caatcaactatcacttggcctgaacaattaggacataaaatagcaattccacacaaagga
gcattaaaatga

DBGET integrated database retrieval system