KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_2330
Entry
USA300HOU_2330    CDS       T00629                                 
Name
(GenBank) hypothetical protein
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
SSDB
Motif
Pfam: PRP9_N DUF3567 LMP COOH-NH2_lig MSP7_C
Other DBs
NCBI-ProteinID: ABX30322
Position
2467364..2467783
AA seq 139 aa
MTDALQQKIHIELLDLLDDVKFELTELNAQKGLYINGPANQLLKRGVHMAYVQGQKQAID
NIMTIVEQQLEDQHFLEHYDKFQNEVAHRNYDKTANFAELSDIPRQFDNFLDQFYQIKGQ
YFIITHINTLIGDFHSEAH
NT seq 420 nt   +upstreamnt  +downstreamnt
atgacagatgcattacaacaaaagattcatatcgaattactagatttattagatgatgtt
aagtttgaattaacagaattaaatgcacaaaaagggttatacattaacggaccagcaaat
cagctacttaagcgtggcgtgcatatggcttatgttcaaggacaaaagcaagccatcgat
aatattatgactattgtggaacaacagcttgaagatcaacatttcctagaacattatgat
aaatttcaaaatgaggttgctcatcgcaattatgataaaacagctaactttgcagaactt
agtgatattccacgtcaattcgataattttttagatcaattttatcaaattaaagggcaa
tactttatcatcacacatatcaatacacttattggtgattttcactcagaagctcattaa

DBGET integrated database retrieval system