KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_2332
Entry
USA300HOU_2332    CDS       T00629                                 
Name
(GenBank) hypothetical membrane protein
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
SSDB
Motif
Pfam: UCH_N
Other DBs
NCBI-ProteinID: ABX30324
Position
2469019..2469657
AA seq 212 aa
MTNPNQRLEPFDETFQQPNIHRGKRYGKKKRSLVSMIIQIIVVILTAIAGYSMWKQPIFN
IVFTKESVDFDGIKNFNETIGKMHQLNINLGNINDLQQGIDRLILVFNGFFILCIVSLVI
TILTIVFNRTVLKVVNILVLTIMLVITLYFSYIIKALAQEIADVFKKYYLNVPPDQVITE
ADAIHNGIILLGCSIGLLVISLFFRNRMPRLK
NT seq 639 nt   +upstreamnt  +downstreamnt
atgacaaatccaaatcaacgattagaaccatttgatgagacatttcaacaaccgaatatt
catcgtggtaagcgatatggtaagaaaaaacgttcattggtaagcatgattattcaaatc
attgttgttatattaaccgcaatcgctggatacagcatgtggaaacaacccatttttaat
attgtcttcaccaaagaatctgtagattttgatggcattaaaaattttaacgagacaatt
ggaaaaatgcatcaattaaatattaatttgggtaatatcaatgatttacaacaaggaatc
gatcgcttaattttagtctttaacggtttctttattttatgtatcgttagcctagtcata
acaatactgacaattgtatttaatcgcacagttctaaaagtagtaaatattttagtgtta
acaattatgttagtcattacattgtatttcagttatattattaaagcactcgcacaagaa
attgcagatgttttcaaaaaatattatttaaatgtaccaccagatcaagtgattacagaa
gctgacgctattcataacggcatcattttacttggctgtagcatcggtttacttgttata
agcttattcttccgtaatcgcatgcctcgtttaaaataa

DBGET integrated database retrieval system