KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_2334
Entry
USA300HOU_2334    CDS       T00629                                 
Name
(GenBank) hypothetical protein
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
SSDB
Motif
Pfam: HlyD_3 HlyD_D23 Biotin_lipoyl_2 Biotin_lipoyl HlyD_2 CusB_dom_1 DUF6672 DUF2118 PASTA Peptidase_M23 DUF3221 SurA_N_3
Other DBs
NCBI-ProteinID: ABX30326
Position
complement(2471847..2472494)
AA seq 215 aa
MKKMILINVITVVVLLAIGIAGFYFWNKTTSYVTTDNAKVNGDQIKIASPASGQIKSLNV
KQGDKLDKGDKVAIVTVQGQDGETKDMDLKMPQKGTIAKLDGMEGSMVQAGNPIAYAYNL
DDLYVTANIDEKDIKDVEVGKDVDVTIDGQKASIKGKVDSIGKATAASFSLMPSSNSDGN
YTKVSQVIPVKITLESEPSKQVVPGMNAEVKIHKN
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaaaaagatgatattaattaatgtcattacggttgttgtactgttagcaattgggatt
gctggcttttatttttggaataaaacaacaagctatgtaacaactgataatgcaaaagta
aatggcgatcaaattaaaatagcaagtcctgcatctggacaaattaaatcacttaatgtt
aaacaaggtgacaaactcgataaaggtgacaaagtagcaattgttactgtacaaggtcaa
gatggcgaaacgaaagatatggatcttaaaatgcctcaaaaaggtacaattgccaaatta
gatggtatggaaggttcaatggtgcaagctggtaacccaatcgcttatgcatacaattta
gatgatttatatgtaacagcaaatattgacgaaaaagatattaaagatgttgaagtaggt
aaagatgttgatgtgactattgacggtcaaaaagcttctattaaaggtaaagttgatagt
attggaaaagcaactgctgcaagcttttcattaatgccatcatcaaatagtgatggtaac
tacactaaagtttctcaagtaatacctgttaaaatcactctagaatcagaaccgtctaaa
caagttgttcctggaatgaacgctgaagtaaaaatccataaaaattaa

DBGET integrated database retrieval system