KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_2336
Entry
USA300HOU_2336    CDS       T00629                                 
Name
(GenBank) TetR family transcriptional regulator
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
SSDB
Motif
Pfam: TetR_C_8 TetR_N HTH_Tnp_1_2 HTH_23
Other DBs
NCBI-ProteinID: ABX30328
Position
2472615..2473166
AA seq 183 aa
MKRQAKIEIQNALVDLMAEYPFQEISTKMICAYCNINRSTFYDYYKDKFDLLDTINSKHK
EKFQFLLSALHHNFENIKQDKLKLYKFFIIIAKYIKHNEQFFKDILVTYPMKTLFIDYIN
LARDYYQQIMNDYSTTVTNKQLYVTYIIGGQAGVFINWLSNGCNESPEEVADILLANTIK
LQN
NT seq 552 nt   +upstreamnt  +downstreamnt
atgaaacgacaagccaaaatagaaattcaaaacgcacttgttgatttgatggctgaatat
ccttttcaagaaatatccactaaaatgatttgcgcgtattgtaatattaatcgttctact
ttttatgattattacaaagataaatttgatttattggataccatcaactcaaagcataag
gaaaaattccaatttcttctaagcgcgctacatcataatttcgaaaatattaaacaggat
aagcttaaactttataaattcttcattattattgctaagtatatcaagcacaatgagcag
tttttcaaagacattttagttacctatccaatgaaaacattattcatagactatataaat
ttagcgagagattactatcaacaaattatgaatgactatagtactacagtaaccaataaa
cagctttatgttacatatatcataggcggtcaagctggggtgtttattaattggctttcg
aatggttgtaatgaatcacctgaagaagttgctgacattttattggctaatacgattaaa
cttcaaaactaa

DBGET integrated database retrieval system