KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_2337
Entry
USA300HOU_2337    CDS       T00629                                 
Symbol
tcaB
Name
(GenBank) MFS family major facilitator transporter, teicoplanin:cation symporter
  KO
K07552  MFS transporter, DHA1 family, multidrug resistance protein
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
Brite
KEGG Orthology (KO) [BR:sax00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sax02000]
    USA300HOU_2337 (tcaB)
Transporters [BR:sax02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    USA300HOU_2337 (tcaB)
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_3
Other DBs
NCBI-ProteinID: ABX30329
Position
complement(2473396..2474604)
AA seq 402 aa
MNDLTHFNKRSPIFIIILGSLTAIGALSIDMFLPGLPDIRHDFQTTTSNAQLTLSMFMIG
LAFGNLFAGPISDSTGRRKPLIIAMIIFTLASLGIVFVHNIWLMVALRFLQGVTGGAAAV
ISRAIASDMYSGNELTKFMALLMLVNGIAPVVAPTIGGIILNYSVWRMVFVILTIFGFVM
VIGSLLKVPESLTVTNRESSSGLKTMFKNFKILLKTPRFVLPMLIQGMTFVILFTYISAS
PFIIQKIYGMTAIQFSWMFAGIGITLIISSQLTGYLVDFIDSQKLMRGMTMIQIIGVILV
TIVLLNHWNFWILAIGFIILIAPVTGVATLGFTIAMDESSSGRGSSSSLLGLVQFLFGGV
ASPLVGVKGEDNPIPYIIIIIATAVILIILQIYNMKVFKTNR
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgaatgatttaacgcattttaacaagcgttcaccgatatttattattattttaggatct
ttgacggccattggagcattatcgatagatatgtttttgcctggattaccagatattaga
catgattttcaaacaacgacgtctaacgcacaattaacattatcgatgtttatgattggt
ttagcgtttggtaatttgtttgctggtccaatttcagattcaactgggcgcagaaagccg
cttattatagctatgattatttttacattagcaagtttaggtattgtttttgtacataat
atttggctgatggttgcattaagatttcttcaaggagtgacaggtggcgcagcagcagtt
atttcaagagctatagcaagtgatatgtatagtggtaatgaactaactaagtttatggca
ttattgatgcttgttaatggtattgcaccagttgttgcgccaacaatagggggcataatt
ttaaattattctgtctggcgtatggtctttgtcattctgactatctttggcttcgtcatg
gtcataggttctttattaaaagtacctgaatcattaacagtgacaaatcgtgagtcaagt
agtggattaaagacaatgtttaaaaacttcaaaatattattgaagacgccacgttttgta
ttaccaatgctcattcaaggtatgacatttgtaatattatttacttatatttctgcgtct
ccgtttattattcaaaaaatttatggcatgactgcaatacaatttagttggatgtttgca
ggaattggtattacgctcattatatcaagtcaacttactgggtaccttgttgattttata
gactcacaaaaattgatgagaggcatgacgatgattcagattatcggtgtaattttagtg
acgattgtattgcttaatcattggaacttttggattttagcgataggatttatcatttta
atagcaccagtgacaggtgttgcgacacttggttttacaatagctatggatgaaagtagt
agtggtagagggagttcatcaagtttattaggtttagtacagtttttatttggtggtgtt
gcatcgccattagtgggggtaaaaggtgaagataatcctataccttacataattattatt
atagctacagcagttatattaattattttacagatttataatatgaaggtatttaaaaca
aatcgatga

DBGET integrated database retrieval system