KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_2395
Entry
USA300HOU_2395    CDS       T00629                                 

Definition
(GenBank) amino acid ABC superfamily ATP binding cassette transporter, binding protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
Pathway
sax02010  ABC transporters
sax02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:sax00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    USA300HOU_2395
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    USA300HOU_2395
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sax02000]
    USA300HOU_2395
   02035 Bacterial motility proteins [BR:sax02035]
    USA300HOU_2395
Transporters [BR:sax02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    USA300HOU_2395
Bacterial motility proteins [BR:sax02035]
 Flagellar system
  Flagellar assembly proteins
   Others
    USA300HOU_2395
SSDB
Motif
Pfam: SBP_bac_3 Phosphonate-bd Lig_chan-Glu_bd InPase NMT1 SspK
Other DBs
NCBI-ProteinID: ABX30385
Position
complement(2535029..2535808)
AA seq 259 aa
MKRLLFVMIAFVFILAACGNNSSKDKEASKDSKTINVGTEGTYAPFSFHDKDGKLTGYDI
DVIKAVAKEEGLKLKFNETSWDSMFAGLDAGRFDVIANQVGINPDREKKYKFSKPYTFSS
AVLVIRENEKDIKDFDDVKGKKLAQTFTSNYGKLAKDKGADITKVDGFNQSMDLLLSKRV
DGTFNDSLSYLDYKKQKPNAKIKAIKGNAEQSRSAFAFSKKADDETVQKFNDGLKKIEEN
GELAKIGKKWFGQDVSKSK
NT seq 780 nt   +upstreamnt  +downstreamnt
atgaaaagacttttatttgtgatgatagctttcgttttcatattggctgcatgcggaaac
aattcgtcgaaagacaaggaagctagtaaagatagcaagacaattaatgttgggactgag
gggacttatgcaccatttagtttccacgataaagatggtaaattaactggttacgatatt
gatgttattaaagcagtggctaaagaagaaggtttaaaacttaaatttaatgaaacttct
tgggattctatgtttgcaggtttagacgcagggcgttttgatgtaatcgcgaaccaagta
ggtattaatcctgatagagaaaagaaatataaattttctaagccttacacattctcaagt
gctgttttagttattcgtgaaaatgaaaaagatattaaagattttgatgatgttaaaggt
aagaagttagcacaaacattcacatctaattatggtaaattagctaaggataaaggtgct
gatattacaaaagttgatggctttaaccaatcaatggatttattattgtctaagcgtgtt
gatggtacatttaatgatagtctgtcatacttggattataaaaaacaaaaacctaatgct
aagatcaaagcaatcaaaggtaatgctgaacaaagtagatctgcatttgcattttctaaa
aaagcagatgatgaaacagttcaaaaattcaatgatggcttgaaaaaaatcgaggaaaac
ggtgaattagctaaaataggtaagaaatggtttggtcaagatgtttctaaatctaaatag

DBGET integrated database retrieval system