KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_2526
Entry
USA300HOU_2526    CDS       T00629                                 

Definition
(GenBank) possible thioredoxin
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
Motif
Pfam: Thioredoxin Thioredoxin_3 Cytochrom_C1 DUF5947 Ldh_1_C Phosducin Toxin-deaminase HyaE
Other DBs
NCBI-ProteinID: ABX30512
Position
complement(2671246..2671590)
AA seq 114 aa
MVKQLNSVEAFREFIHQYPLAVVHVMRDQCSVCHAVLPQIEDLMQSYPNVPLAVINQSQV
EAIAGELNIFTVPVDLIFMNGKEMHRQGRFIDMQRFEHHLKQMNDSVNNDVDEH
NT seq 345 nt   +upstreamnt  +downstreamnt
atggttaagcaattaaatagtgtcgaagcattccgtgaatttattcatcaatatccgtta
gcagttgtacatgtcatgcgcgatcagtgtagcgtgtgtcatgccgttttaccacaaatt
gaagacttgatgcaatcatatcccaatgtgccattagctgtgattaatcaaagtcaggtg
gaagctattgctggagaattaaatattttcactgtacctgtggatttaatttttatgaat
ggaaaagaaatgcatcgtcaagggcgttttatcgatatgcaacgttttgaacatcatctt
aagcaaatgaatgatagtgtaaataacgatgtcgatgagcattaa

DBGET integrated database retrieval system