KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_2647
Entry
USA300HOU_2647    CDS       T00629                                 

Name
(GenBank) hypothetical protein
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
SSDB
Motif
Pfam: DUF6365
Other DBs
NCBI-ProteinID: ABX30633
Position
complement(2800856..2802214)
AA seq 452 aa
MIKLFDYFNDHSRKLYESFKASKLEEDLTIVLNDNGFLPDDVISPYQFFADNHNTENMKP
RFFNQVTVPAFWEIKGNNNSATINDMGRLRGKIFYQSGERPRIVSRVEWFDDQQRVRFVD
YYSKNGIKFAQTVYDLNRKAILKKYMTAEGKEVIYENFVTSDVILDWQGKSYFFPSKLAF
ALFFIKQLEITEHHFVINSLALPFSVLYNLPSKGSDVLVWQEHCNGNVPGNMQLMCKGDM
KRHCNIIIPDKNEYETMLNIADAKVQSRILQGGYLYNYRSRNRYTKEIVILTNSDQLRNI
KVLVETLPDFKFHIAAITEMSDKLMQLDQYANVHLYPSINIDRVNELYQLCDIYLDINEG
NEILNAVEQAFDYELLILGYRQTAHHAKVTLSEHLFEHNDEITMESKDQLIQMLESLKDQ
QQFRDALLAQKAHAHEISREQFEQVFKQALES
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgattaaattatttgattactttaacgatcattcacgaaagttatatgagtcttttaaa
gccagtaagttggaagaagatttaacaattgtactcaatgacaatggctttttaccggac
gatgttatatcaccgtatcaattttttgcagataatcataatacagaaaatatgaaacca
cgattttttaatcaggttactgtaccagctttttgggaaattaaaggtaacaacaattcg
gctacaattaatgatatgggacgtctacgaggtaaaatattttatcaaagtggagagcgc
cctagaattgttagtcgtgtcgaatggtttgatgaccaacaacgtgtccgatttgtcgat
tattattctaagaatggtattaaatttgcacaaactgtttacgatttaaatcgtaaagcg
atcttgaagaaatatatgacagcagaaggtaaagaagtgatttatgaaaattttgtaaca
tctgatgtcatattggattggcaagggaagtcttactttttcccttcaaagctcgcattc
gcattattttttatcaagcaacttgaaattacggaacatcatttcgttattaactcacta
gccctaccattttcagtgttatataatttgccatcaaaaggtagtgatgttttggtatgg
caagaacactgtaatggtaatgtcccgggaaatatgcaattgatgtgtaaaggtgatatg
aaacgacattgtaatattattattccagataaaaacgaatatgaaacgatgctcaatata
gcagacgcaaaggttcaatctcgtattttacaaggcggatatctatataactatcgtagt
cgtaatagatatactaaagaaattgtaatattaactaactcggatcaacttcgtaacatc
aaggtattggttgaaactttaccagattttaagtttcacatcgctgctattacagagatg
tctgataagctaatgcaacttgatcaatatgctaatgtgcatttatacccatctattaat
attgacagggtaaatgaactataccagttatgtgatatttatcttgatatcaatgagggt
aatgaaattttaaatgcggtggaacaagcgtttgactatgagttgttgattttaggttat
cgtcaaaccgcacaccatgctaaagtaacattatcagagcacttatttgagcataatgat
gagataacaatggaaagtaaagaccaattaatacaaatgttagaaagtttgaaagatcaa
caacagtttcgagatgctttattagcacaaaaagcacatgcacacgaaatctcgcgtgaa
caattcgagcaagtttttaaacaggcgctcgaaagctaa

DBGET integrated database retrieval system