KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_2685
Entry
USA300HOU_2685    CDS       T00629                                 

Name
(GenBank) cobalt (Co2+) ABC superfamily ATP binding cassette transporter, membrane protein
  KO
K16785  energy-coupling factor transport system permease protein
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
Pathway
sax02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sax00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    USA300HOU_2685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sax02000]
    USA300HOU_2685
Transporters [BR:sax02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    USA300HOU_2685
SSDB
Motif
Pfam: CbiQ DUF5762 PDR_CDR
Other DBs
NCBI-ProteinID: ABX30671
Position
complement(2842770..2843603)
AA seq 277 aa
MNQYNTIGFHPGNSRIHQLNATVKLLFLLVVSISAMVTYDTRYLILISASSILLVKYAHI
EWKQVRFVVKFILFFTILNIIAVYIFDPEYGVKIYNQRTELVNGIGRFTLTSQELFYLFN
LILKYISTVPLALIFLFTTNPSHFAASLNQLGVNYKISYAVSLALRYIPDIQETYFNISQ
AQQARGYDNSKKAKFTSRVKGIKRIVLPLIFSSIERIDTISTAMELRQFGQYKRRTWYVK
KQLKKDDYVVLCLTLILLMLVVTLFFLNNSRYFNPWH
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaatcaatataatactataggttttcacccgggaaatagtcgtattcatcaattaaat
gcgactgttaaacttttattcttattagttgtttctatttctgcaatggtgacttatgac
acaagatatttaattttaattagtgcttcatctattttattggtcaaatatgctcatatt
gaatggaaacaagttcgctttgttgttaaattcattctgtttttcacaatattaaatatt
attgccgtgtacatatttgaccctgaatatggtgtgaagatttataatcagcgtacagag
ttagtcaatggtattggtcgatttacgctaacatcacaggaattattctatctttttaat
ctaatattaaaatatattagtacagttcctttagcgttaatatttttattcacaacgaat
ccgagtcattttgctgcaagtttaaatcagctaggtgtgaattataaaatcagttacgca
gtctcactagcattaaggtatattccagatattcaagaaacatattttaatatttcacaa
gcgcaacaagcaagaggatatgataattcgaaaaaagcaaaatttactagccgtgttaaa
ggtatcaaacgcattgtgttacctttaatattttctagtatcgaaagaattgacactatt
agtactgctatggagttaagacaattcggacagtataaaaggagaacctggtacgtcaaa
aaacaattaaaaaaagatgattatgttgttttgtgtttgacgttaatacttctgatgtta
gtagttacattattctttttaaataatagtcgatatttcaacccgtggcattag

DBGET integrated database retrieval system