KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_0216Help
Entry
USA300HOU_0216    CDS       T00629                                 

Gene name
ggt
Definition
(GenBank) T3 family gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
Pathway
sax00430  Taurine and hypotaurine metabolism
sax00460  Cyanoamino acid metabolism
sax00480  Glutathione metabolism
sax01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sax00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    USA300HOU_0216 (ggt)
   00460 Cyanoamino acid metabolism
    USA300HOU_0216 (ggt)
   00480 Glutathione metabolism
    USA300HOU_0216 (ggt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sax01002]
    USA300HOU_0216 (ggt)
Enzymes [BR:sax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     USA300HOU_0216 (ggt)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     USA300HOU_0216 (ggt)
Peptidases and inhibitors [BR:sax01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   USA300HOU_0216 (ggt)
CD molecules [BR:sax04090]
 Proteins
  USA300HOU_0216 (ggt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ABX28247
Position
240993..242999
Genome map
AA seq 668 aa AA seqDB search
MVINLNDKQTKTSKEGLISVSHPLAAKIGKDVLDQGGNAMDAVIAIQLALNVLEPFASGI
GGGGYLLYYEQSTGSITAFDARETAPEHVDKQFYLDDSGEYKSFFDMTTHGKTVAVPAIP
KLFDYIHKRYAKLSLEDLINPAIELAIEGHAANWATEKYSRQQHARLTKYHETAQVFTHE
NQYWREGDWIVQPELGKTFQILREQGFNAFYKGDIAKQLVNVVKACGGTITLEDLAKYDI
QIKAPISATFKDYDIYSMGPSSSGGITVIQILKLLEHVDLPSMGPRSVDYLHHLIQAMHL
AYSDRAQYLADDNFHEVPVQSLIDDDYLKARSTLIDSNKANIDIEHGVVSDCISHTDVEE
NHTETTHFCVIDKEGNIASFTTSIGMIYGSGITIPGYGVLLNTTMDGFDVVDGGINEIAP
YKRPLSNMAPTIVMYHGKPILTVGAPGAISIIASVAQTLINVLVFGMDIQQAIDEPRIYS
SHPNRIEWEPQFSQSTILALIAHGHAMEHKPDAYIGDVHGLQVDPTTYEASGGSDDTREG
TVMGGEVLVIRKQPLPYRQMYDSDGFRLYFNDVQLPLLADQVRWMHDKYWVDESVVRIIF
PEVSAHIEDLRSYENAGENYIDIAWLARKYAYQVTLKDDGLYLTDDTYTSVKRNTNAYYR
YDRDSITR
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggtcattaacttaaatgacaaacagacaaaaacatctaaagaagggttaatttccgta
tcacatcctcttgcggctaaaattggtaaggatgtattagatcaaggtggcaacgccatg
gatgcagtgattgcaattcaactggcattgaatgtgttagaaccatttgcatcaggtatt
ggtggtggcgggtatttgctatattatgagcaaagtactggcagtataactgcgtttgat
gcacgtgagacagcacctgaacatgtagacaaacaattttatctagatgattcaggcgaa
tataaatcattttttgatatgactacacatggtaaaactgtcgctgtgccagcaattcca
aagctgtttgattatattcacaagcgttatgctaaattgtcattggaagatttaattaat
cctgcaattgaactagccattgaaggtcatgcagccaattgggctactgaaaaatattcg
cgccagcaacacgcacgattgacaaagtatcatgaaacggcacaagtatttacgcatgaa
aatcaatattggcgtgaaggtgattggattgtacaacccgaattaggtaagacatttcaa
atattaagagaacaagggtttaatgcattttataaaggtgacattgcgaaacaattagtc
aatgttgtcaaagcatgtggtgggacaatcactttagaggatctagccaaatatgacatt
cagattaaagcgccaatcagtgcaacatttaaagactatgacatttattcaatgggacca
tctagttctggcggtatcacggtaattcaaatattgaagttattagaacatgtcgattta
ccatctatgggtccaagatctgttgattacttgcatcatttgatacaagcgatgcattta
gcatatagtgatcgtgcgcaatacttggcggatgataattttcatgaggtgcctgtacag
tcattaattgatgatgattatttaaaagcacgcagtacgctcattgatagcaataaagca
aatattgatatagagcatggtgttgtgtctgattgcattagtcatacagatgttgaagaa
aatcataccgaaacaactcatttttgtgtgattgataaggaaggtaatattgcttcattt
acgacatcaattggtatgatttatggttcaggtatcacgattccaggctacggtgtgtta
ttgaatacgacaatggatggctttgatgtagtagatggtggtattaacgaaattgcacca
tataaacgaccactaagtaacatggctccaacgattgtgatgtatcacgggaagccaata
ttaacagtaggtgcacctggtgccataagtatcattgctagtgttgcgcaaacattaatc
aatgtattagtgtttggcatggatattcagcaggctatagatgaacctagaatttatagt
agccatcctaatcgcattgaatgggagcctcaattttcacaatctacaatattagcattg
attgcacatggacatgcaatggaacataaaccagatgcttatattggagatgtacatgga
ctacaggttgacccaacaacgtatgaagcttcgggtggaagtgatgatactagagaaggc
accgtaatgggtggcgaggtgttagtgattagaaaacagccattaccatatcggcaaatg
tatgatagtgacggctttcgtctatatttcaatgatgtgcagttacctttattggcagat
caagtgcgatggatgcatgacaaatattgggttgatgaaagtgttgttagaatcattttc
cctgaagttagtgcacatattgaagatttaagaagttatgaaaacgcaggagaaaattat
atagatattgcctggttagcacggaaatatgcttatcaagtaacattgaaggatgacggt
ttatacttaactgatgatacatatacttcagtgaaacggaacacaaatgcatactataga
tatgatcgagatagtatcacaagatag

DBGET integrated database retrieval system