KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA): USA300HOU_0375Help
Entry
USA300HOU_0375    CDS       T00629                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MSSA)
Pathway
sax00071  Fatty acid degradation
sax00072  Synthesis and degradation of ketone bodies
sax00280  Valine, leucine and isoleucine degradation
sax00310  Lysine degradation
sax00362  Benzoate degradation
sax00380  Tryptophan metabolism
sax00620  Pyruvate metabolism
sax00630  Glyoxylate and dicarboxylate metabolism
sax00640  Propanoate metabolism
sax00650  Butanoate metabolism
sax00900  Terpenoid backbone biosynthesis
sax01100  Metabolic pathways
sax01110  Biosynthesis of secondary metabolites
sax01120  Microbial metabolism in diverse environments
sax01130  Biosynthesis of antibiotics
sax01200  Carbon metabolism
sax01212  Fatty acid metabolism
sax02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    USA300HOU_0375
   00630 Glyoxylate and dicarboxylate metabolism
    USA300HOU_0375
   00640 Propanoate metabolism
    USA300HOU_0375
   00650 Butanoate metabolism
    USA300HOU_0375
  09103 Lipid metabolism
   00071 Fatty acid degradation
    USA300HOU_0375
   00072 Synthesis and degradation of ketone bodies
    USA300HOU_0375
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    USA300HOU_0375
   00310 Lysine degradation
    USA300HOU_0375
   00380 Tryptophan metabolism
    USA300HOU_0375
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    USA300HOU_0375
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    USA300HOU_0375
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    USA300HOU_0375
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sax04147]
    USA300HOU_0375
Enzymes [BR:sax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     USA300HOU_0375
Exosome [BR:sax04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   USA300HOU_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: ABX28405
Position
405904..407085
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattgatgaagttatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacggtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcgtagtcactaaggatgaaggtgta
cgtgaaaatgtatcagtcgaaaaattaagtcgattaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatccttctattatgggtattgcaccagttggcgctgtagaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgttgatcgtgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacatcctattggtgcatctggtgctagagtattagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system