KEGG   Sulfobacillus acidophilus TPY: TPY_0226Help
Entry
TPY_0226          CDS       T01576                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
say00790  Folate biosynthesis
say01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TPY_0226 (folP)
Enzymes [BR:say01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     TPY_0226 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEJ38441
UniProt: F8I4Z3
Position
238992..239822
Genome map
AA seq 276 aa AA seqDB search
MSRQFHWGRGTWTFGQRIYVLGILNLTPDSFSDGHPANLDPEVILERARQMVEDGVDGFD
VGAESTRPGYRPVPWQEEWDRLQTVLPRLREAFSHLPISVDTQKAEVAERALAAGADIIN
DVTGFTRPEMVAVAQASRAGIILMFNQDAVFPPGTVTIHHLTAFFQAQLDRMQAAGVAPD
RILIDPGLGFAYRGDDNWRILQELPHLKGFGAGLLVGHSRKSFLGQVTGHARPTDRDPAT
AALTAVVGTLGADVVRVHRVDWNRDAVRVAEVWRRS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagccgacaatttcactggggccggggtacgtggactttcgggcagcggatctatgtc
ctgggcattttgaatctaaccccggactccttttctgacgggcatccggccaatttggac
cctgaggtcattttggaacgggctcgacaaatggtcgaagacggagtcgacgggtttgat
gtcggggccgaatccacccggcccggatatcgcccggtcccgtggcaagaggagtgggac
aggctccagacggttcttccgcggctacgcgaggcgtttagccatttaccgatatcggtg
gatacccaaaaggccgaagtggccgaacgggctttggcggcgggagccgatatcataaac
gatgtgacggggtttacccgtccggaaatggtagccgtggcccaagcgtcccgagccggc
atcattctcatgtttaatcaagacgcggtctttcctcccggcaccgtcaccatccatcat
ttaacggcgttttttcaagctcaattagaccggatgcaggcggcgggggttgcccccgac
cggatcctcatcgaccccggcctcgggtttgcctatcggggtgacgataactggcggatt
ctccaagaactaccccatctgaaagggtttggcgccgggcttttagtgggacatagccgg
aagagctttttagggcaagtgaccggtcatgcccgaccgacggatcgggacccggcgacg
gcggccttaacggccgtggtcggcacgctcggtgccgatgtggtccgtgtgcatcgggtg
gactggaatcgggacgccgtccgggtggccgaagtgtggaggcgctcataa

DBGET integrated database retrieval system