KEGG   Sulfobacillus acidophilus TPY: TPY_0328Help
Entry
TPY_0328          CDS       T01576                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
say  Sulfobacillus acidophilus TPY
Pathway
say03010  Ribosome
Brite
KEGG Orthology (KO) [BR:say00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    TPY_0328 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:say03011]
    TPY_0328 (rplV)
Ribosome [BR:say03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    TPY_0328 (rplV)
  Bacteria
    TPY_0328 (rplV)
  Archaea
    TPY_0328 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 TetR_C_29
Motif
Other DBs
NCBI-ProteinID: AEJ38530
Position
334517..334876
Genome map
AA seq 119 aa AA seqDB search
MAMEEVAEARAHVRHVRIAPRKVRIVVNLIRGKDLRDAQAILRHTPKRASRIVAKLLQSA
AANAQHNHDLDPRDLYVHAIWVDGGPILKRIHPRSRGQAFPIMKRTSHISVVLRPRHSR
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggaagaagttgcggaagcgcgcgcccatgtgcgtcacgtgcgcatcgcgccg
cggaaggtgcgaattgtggtgaatttgattcggggcaaagatctgcgggatgcacaagcc
attttacgccatacgcccaaacgggcgtcacgcatcgtggcgaaattgttgcaaagtgcg
gccgccaacgcccaacacaatcatgacctagacccgcgggacttgtatgtgcatgcgatt
tgggttgatggtggaccgattctgaagcggattcatccccgtagccgtgggcaggccttt
ccgattatgaaacggacgagtcatatttctgtggtgctgcggccgcggcattcacgctag

DBGET integrated database retrieval system