KEGG   Sulfobacillus acidophilus TPY: TPY_1088Help
Entry
TPY_1088          CDS       T01576                                 

Gene name
asnB
Definition
(GenBank) asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
say00250  Alanine, aspartate and glutamate metabolism
say01100  Metabolic pathways
say01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TPY_1088 (asnB)
Enzymes [BR:say01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     TPY_1088 (asnB)
Peptidases [BR:say01002]
 Cysteine Peptidases
  Family C44
   TPY_1088 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase QueC DUF1933 tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: AEJ39278
UniProt: F8IBX8
Position
complement(1018121..1019965)
Genome map
AA seq 614 aa AA seqDB search
MCGIAGWIDWQQNVVAHQRDLENMAAPMTCRGPDGSGSWVTPRAGLAHRRLIVIDPEGGM
QPMSKREHGHVYTIVYNGELYNFQELRQQLTALGHTFRSRSDTEVLLTAYMAWGEGALER
LNGIYAFAIWDSDRQTLFLARDRLGVKPLFYAQTPSGLVFASEIKGILAHPAIRPEVDRT
GLAEIFTLGPARTPGHAIFRQIRELRPGEYAIYRPSGLTVRPYWHLESHPHPDSVEKTAE
TIEALLWDAVEKQLVADVPVVTLLSGGLDSSLVTAMAQKAFREQQKDALGTFSIQFKDMA
RYFRDNGFQTNLDDPWVTRVAEFLETTHQRVELDTPELDEYLIPALLARDVPGHADVDTS
LLVFAQHIKERATVGLSGEAADEIFGGYPWFHRADALAAHTFPWSLRLRDRIRVLAPELI
DYLKPEQYVQDRYDEALAEVPHLAGESPESARIREIAYLSITRFLPTLLERKDRMTMAAS
LEVRVPYCDHRLVEYVWNIPWEMKNYGGHPKGILRLAAERWLPSDVVYRRKSPYPSTVNP
SYFYRMADRLQAILEDTHSPLRPLVNQTVLRNMIAAGPDAAQIPWFGQLMGNAQLFAFLI
QTDAWLRHYHVTFV
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatagccggctggatagattggcaacaaaacgtggtcgcccatcagcgcgat
ctggagaacatggcggcccccatgacctgccgcggcccggatggtagcggaagctgggta
acgccgcgggccggtttggcgcaccgtcggctgatcgtcatcgaccccgaaggcggcatg
caacccatgtcgaaacgcgaacacggtcatgtatataccattgtttataatggggaactg
tataattttcaagaactccgccaacaactcaccgccctcggccataccttccgcagccgt
tcggacacggaagtcttgttgaccgcctacatggcttggggagaaggggctttggaacgg
ctgaacggcatctatgcgttcgcgatttgggacagcgaccggcaaaccttgtttcttgct
cgcgatcggttgggcgtcaagcctttgttctatgcccaaaccccgtcgggcctggtgttc
gcctcggaaatcaaagggattttagcccacccggccatccgaccggaagtcgaccgcacg
ggcttggccgaaatctttaccttgggtccggcgcgcaccccggggcatgcgatctttcgg
cagattcgagagcttcgcccgggtgagtatgcgatttaccgcccttccgggttaaccgta
cgaccctattggcacttggaaagccatccccatcccgattcggtcgaaaaaaccgcagaa
accattgaagccttgttgtgggacgcggtcgaaaagcaattggtggcggatgttccggtg
gtcacccttctctccggcgggttagactccagcttggtcaccgccatggcccaaaaagct
tttcgggagcaacagaaagatgctctagggacattttccatccaatttaaagatatggcc
cgctattttcgggataacgggtttcagaccaatttggacgatccctgggtcacccgcgtg
gccgaattcctggagacgacgcatcagcgggtggagttggacactcccgagctggatgag
tacctcattccggctcttctggctcgcgatgtccccggccacgccgatgtcgacacctcg
cttttggtcttcgcccagcatattaaagaacgcgcgacggtgggcctctccggcgaagcc
gccgacgagattttcggcggttatccttggtttcaccgtgccgatgctctcgccgcccat
accttcccctggtcgctaaggctccgcgatcgtatccgcgtattggcccccgagctcatc
gactatctaaaaccggaacagtatgtccaagatcgctatgacgaagccttggccgaagtg
ccccacctggccggggagtcgccggagtcggcccgcattcgagaaattgcctatctcagc
atcacccggtttttacccacgttattggaacgcaaagaccggatgaccatggcggccagc
ctcgaggtgcgagtcccctactgtgatcatcgcctcgtggaatatgtttggaacatcccc
tgggagatgaaaaactatggcggtcaccccaaagggattttacgattggccgcggaacgc
tggctgccttcggatgtggtctaccgccgcaaatcgccctatccgtcgacagtgaacccg
agctatttttatcgcatggctgatcggctccaagcaatactggaggatacccactcgcct
ttgcgaccgctcgtgaatcagacggtactacggaacatgatcgccgccggccccgatgcc
gcgcaaattccttggtttggccaactgatgggcaatgctcagctctttgcctttttgatt
caaaccgatgcgtggctccgccattaccacgtgacgttcgtctaa

DBGET integrated database retrieval system