KEGG   Sulfobacillus acidophilus TPY: TPY_2022Help
Entry
TPY_2022          CDS       T01576                                 

Gene name
melA
Definition
(GenBank) glycoside hydrolase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
say00052  Galactose metabolism
say00561  Glycerolipid metabolism
say01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TPY_2022 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    TPY_2022 (melA)
   00600 Sphingolipid metabolism
    TPY_2022 (melA)
Enzymes [BR:say01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     TPY_2022 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C
Motif
Other DBs
NCBI-ProteinID: AEJ40202
UniProt: F8I9B2
Position
complement(1929376..1930710)
Genome map
AA seq 444 aa AA seqDB search
MVKITLVGAGSMHFTRDLIWNLLLHPQADRIEWRLFDIDADRLRISYRLVQEIGRQLHVT
PRAVTVDTQREALQGADFVINVVQVGGFEATRRDFDIPERYGIVQTIGDTLGVGGIFRAL
RTIPVVLDLVRDMEDVCPEAVLLNYTNPLSMVVMAIARISGIQAYGLCESPRTTADTLSR
YLEIPPDRLNWMTAGINHMAWVLRLEAEGRDLYPTLRSLADDPETWRKDAVRFELMKAFG
YFVTESSEHNAEYGPWFITHPDEIRRLGIPLGELLRRSANYLRDFEAYKTEGIREDFTFP
RHPPFQYAAELITHWMTGEDLTFYGSVMNHGLIDNIMPTIAVEVPCVLTQGEIFPVHVGP
LPDVLAALNNRAGAIQDLTVQAVLRRNREDLYHALLLDPVVSSRLTVDQTVSLANELLEA
HKGIVPELKTRRVFGNTSFSGEGT
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaattacgctcgtcggcgccggaagcatgcattttacccgtgatttgatatgg
aatctattattacatccccaggcggaccggattgaatggcggttatttgatatcgatgcc
gaccggttacggatttcgtatcgtctggttcaggaaatcggccgtcaacttcacgtaaca
cctcgggcggtgaccgttgatacgcaacgggaagctttgcagggggcggattttgtaatc
aacgtggttcaagtaggcggatttgaggcgacccgacgggattttgacatacccgaacgg
tacgggatcgtccagactatcggggataccctgggggtcggcgggattttccgtgcgctt
cggaccattccggtggtgcttgatttggtccgagatatggaagacgtatgtccggaggcc
gtcttgttaaactacacgaacccgttgtccatggtcgtcatggcaattgccaggatcagc
ggcatccaggcgtacgggctatgtgaaagtcctcgcaccaccgcggacactttgtcccgc
taccttgaaattccgccggaccggttaaactggatgaccgccggcattaaccacatggcg
tgggttctccgattggaggcggagggccgggacctatacccgacattgagatcgttggcc
gatgatcccgagacctggcgaaaggatgcggtgcgattcgaattaatgaaagcgttcggc
tatttcgtgaccgagtcgagcgaacataacgccgaatacggtccttggttcataactcac
cccgacgagattcggcgcctgggcattccccttggcgaactgctgcggcgaagcgccaac
tatctccgcgacttcgaggcctataaaaccgagggtattcgcgaagattttacttttccg
agacacccgccttttcaatatgccgccgagctgatcacacattggatgactggagaagac
ctgacgttttacggtagcgtcatgaatcacggcttaatagacaacatcatgccgaccatt
gccgtggaggttccctgcgtattgactcaaggtgagatttttccggtgcatgtgggcccc
ttgccggacgtgctggcggctttgaataatcgcgccggtgcgattcaggatctgacagtt
caggcagtgcttcgacgtaaccgggaggacttgtatcatgccttgttattggacccggtc
gtgtcgagccgattaaccgtggatcaaaccgtttcgttggccaacgagttgttggaggcc
cataaggggatcgttcccgaacttaaaacccgtcgcgtcttcgggaacacgtcattctcc
ggggagggtacatga

DBGET integrated database retrieval system