KEGG   Sulfobacillus acidophilus TPY: TPY_2449Help
Entry
TPY_2449          CDS       T01576                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
say00071  Fatty acid degradation
say00072  Synthesis and degradation of ketone bodies
say00280  Valine, leucine and isoleucine degradation
say00310  Lysine degradation
say00362  Benzoate degradation
say00380  Tryptophan metabolism
say00620  Pyruvate metabolism
say00630  Glyoxylate and dicarboxylate metabolism
say00640  Propanoate metabolism
say00650  Butanoate metabolism
say00900  Terpenoid backbone biosynthesis
say01100  Metabolic pathways
say01110  Biosynthesis of secondary metabolites
say01120  Microbial metabolism in diverse environments
say01130  Biosynthesis of antibiotics
say01200  Carbon metabolism
say01212  Fatty acid metabolism
say02020  Two-component system
Brite
KEGG Orthology (KO) [BR:say00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TPY_2449 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    TPY_2449 (atoB)
   00640 Propanoate metabolism
    TPY_2449 (atoB)
   00650 Butanoate metabolism
    TPY_2449 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TPY_2449 (atoB)
   00072 Synthesis and degradation of ketone bodies
    TPY_2449 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TPY_2449 (atoB)
   00310 Lysine degradation
    TPY_2449 (atoB)
   00380 Tryptophan metabolism
    TPY_2449 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TPY_2449 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TPY_2449 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TPY_2449 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:say04147]
    TPY_2449 (atoB)
Enzymes [BR:say01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TPY_2449 (atoB)
Exosome [BR:say04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TPY_2449 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEJ40609
UniProt: F8I210
Position
complement(2275683..2276879)
Genome map
AA seq 398 aa AA seqDB search
MLMSRDTEIYVLGGARTPFGSYGGHLRQVNAVELARVAATAAIERSGIPASAIDLSVVGG
VLPSTPDAAYLARHVALAAQAPIEAPALTVNRLCGSGLQAVISGAQSLALGDGQVALVGG
TENMSQAPYVLFGSRWGIKDGPPTLDDTLQEALTDSACGLGMGMTAENLAEQYHISREAQ
DAFAALSHQRAHAAEAAGIFAEEIVPVPVTQRGVTELWDRDEHIRPDTTVESLSRLKPVF
KKPDGTVTAGNASGINDGAAMLVIATGDFVRAHGLKPWARIVSYGVAGVDPRIMGIGPVP
ASRQALERAGLGWEDIGRIEINEAFAAQYLAVEQELNLDREITNVHGGAIALGHPVGASG
ARLLLTLALEMKRARVHYGLASLCIGGGQGISMVIETV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgttgatgtcacgggatacggaaatctatgtgctgggcggtgcccgtacgcctttcggc
agttatggcgggcatctacggcaggttaatgccgtcgagctggcgcgcgtcgcggcgacg
gcggcgattgagcggagcggcattcccgcttcggcgattgatctcagcgtggtaggcggg
gtgttaccgtcgacccccgatgccgcctacttagcccgtcatgtggcgctggcggctcaa
gcaccgattgaggccccggccttaaccgtcaaccggctatgcggttccggattacaagcg
gtgatttcgggagcacaatctcttgcgctgggtgatggacaggtggcgctcgtcggcggc
accgagaatatgagtcaggcgccctatgtcctgttcgggagtcgttgggggatcaaagat
ggtccgcccacattggatgacacgttacaagaggctttaaccgactcggcttgcggactc
gggatggggatgacggcggaaaatctggcggagcaatatcacatttcccgcgaggcgcaa
gatgcgtttgccgccttaagccatcaacgggcgcacgcggccgaggcggccggcattttt
gccgaggagatcgtccccgtaccggtgacccaacgcggtgtgaccgagctttgggaccga
gacgaacatatccgtccggatacgacggtagagagcttgagccgattaaagccggtgttt
aaaaagccggacgggaccgtcacggcgggtaacgcgtccgggattaacgacggagcggcc
atgttggtgattgccaccggggactttgtccgtgcccacgggttaaaaccttgggcccgg
attgtgagttacggggtggcgggggtggatccgcggataatgggcatcggtcccgtgccg
gcctcccgtcaagcgctcgagcgggccggactcggatgggaggacatcgggcgtatcgaa
atcaatgaagcgtttgccgcgcaatatttggccgtggaacaagagctgaacttggatcgc
gaaattaccaacgtccatggcggcgccatcgccttagggcatccggtgggggcatcaggg
gcgcgcttgttgctgacgttggcgctggaaatgaagcgggcccgcgtccattatggattg
gcttcgctgtgcattggtggcgggcaaggaatttctatggtgattgagacggtataa

DBGET integrated database retrieval system