KEGG   Shewanella amazonensis: Sama_1498
Entry
Sama_1498         CDS       T00445                                 

Name
(GenBank) Formate C-acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
saz  Shewanella amazonensis
Pathway
saz00620  Pyruvate metabolism
saz00640  Propanoate metabolism
saz00650  Butanoate metabolism
saz01100  Metabolic pathways
saz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:saz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sama_1498
   00640 Propanoate metabolism
    Sama_1498
   00650 Butanoate metabolism
    Sama_1498
Enzymes [BR:saz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Sama_1498
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ABL99705
UniProt: A1S5P9
Position
complement(1812619..1814901)
AA seq 760 aa
MTDKTELFQTAWEGFVPGDWKSDVNVRDFIQTNYTPYEGDDSFLAGPTAATNALWAKVME
GIKEENRTHAPLDFDTDKVSTITSHDAGYIEKELETIVGLQTDAPLKRAMLPNGGIRMVE
SSCAAYNRELNADIKYVYSELRKTHNQGVFDIYTPEILACRKSGVLTGLPDAYGRGRIIG
DYRRVALYGIDYLMADKLKQFTSLQSRFEEGEDLQATMQLREEIAEQHRALAQMKKMAAK
YGYDISGPAKNAQEAIQWTYFGYLAAVKSQNGAAMSLGRTSSFIDIYIERDLKNGTLTEE
QAQEMIDHFVMKLRMVRFLRTPEYDELFSGDPIWATESIGGMGLDGRTLVTKSSFRFLHT
LYNMGPSPEPNITVLWSEKLPENFKTFCAKVSIDTSSIQYENDDLMRPDFESDDYAIACC
VSPMVVGKHMQFFGARANLAKTMLYAINGGVDEKLKVQIGPKSEPITSEYLDYDDVMSRL
DNLMEWLATQYVSALNAIHFMHDKYSYEAALMALHDRDVRRTMACGIAGLSIAADSLSAI
KYAKVKPVRDEHGIAVDFEIEGDYPKFGNNDARVDDIACMLVEGFMAKIRNKKMYRNAIP
TQSILTITSNVVYGKKTGNTPDGRRAGAPFAPGANPMHGRDEKGAIASLTSVAKLPFAHA
QDGISYTFSIVPNALGKDEKARERNLAALMDGYFRHSEGREGGQHLNVNVMNREMLEDAI
ANPDKYPQLTIRVSGYAVRFNSLTPEQQQDVITRTFTQGL
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgaccgataaaactgagctgttccaaaccgcgtgggaaggattcgttcccggtgattgg
aagtccgacgtcaatgtacgtgactttattcagaccaactacaccccttatgaaggtgac
gacagcttcctggccggccccaccgccgctaccaacgccctgtgggccaaggtgatggaa
ggtatcaaggaagaaaaccgcacccacgcgccgctggactttgataccgacaaggtatcg
accatcacttcccacgatgccggttatatcgaaaaagagctggaaaccattgttggtctg
caaaccgatgcgccactcaagcgcgccatgctgccaaacggcggtatccgtatggtggaa
agctcctgcgccgcctacaaccgtgaactgaatgccgacatcaagtatgtgtattctgag
ctgcgcaagacccacaaccagggcgtattcgacatctataccccggaaatccttgcctgc
cgtaaatccggcgtgctgaccggcctgcccgatgcctatggccgtggccgtatcattggt
gactaccgccgcgtggccctgtacggtatcgattacctgatggccgataaactgaagcaa
ttcacctcgctgcaatcccgttttgaagaaggtgaagatctgcaggccaccatgcagcta
cgcgaagaaatcgccgagcagcaccgcgctctggcccagatgaagaaaatggccgcgaaa
tacggctacgacatttctggccccgccaaaaacgcccaggaagccattcagtggacctac
tttggctaccttgctgcggtgaagagccaaaacggtgccgccatgtcccttggccgtact
tccagctttatcgacatctacattgagcgtgacctgaaaaacggtactctgaccgaagag
caggcgcaggagatgattgaccatttcgtgatgaagctgcgcatggtgcgcttcctgcgt
acccctgagtacgatgaactgttctccggcgacccaatctgggccaccgaatcaatcggc
ggtatgggtcttgatggccgtactctggtgaccaagtccagcttccgcttcctgcatacc
ctgtacaacatgggcccaagcccagagccaaacatcactgtgctctggtctgaaaagctg
ccagaaaacttcaaaaccttctgtgccaaggtgtccatcgacaccagctccatccagtac
gaaaacgatgacctgatgcgtccggacttcgagtctgacgactatgccatcgcctgctgc
gtcagccccatggtggtgggtaagcacatgcagttcttcggtgcccgtgccaacctcgcc
aagaccatgctgtatgccatcaacggtggcgtagacgaaaagctgaaagtgcagataggt
cctaaatctgagcctatcaccagcgagtacctggactatgacgatgtcatgagtcgtctg
gataacctgatggagtggctggcgacccagtatgtctctgcgctgaacgccattcacttt
atgcacgacaagtattcttacgaagccgcgctgatggcgctgcacgaccgcgacgtgcgc
cgcaccatggcctgtggtatcgccggtctgtccattgctgccgactccctgtctgccatc
aagtacgccaaggtgaagccggtacgcgacgagcacggcatcgccgttgacttcgaaatt
gagggtgactatcccaagttcggtaacaacgatgcccgcgtggatgatatcgcctgtatg
ctggttgaaggctttatggccaaaattcgcaacaagaagatgtaccgcaacgccatccca
acccagtctatcctgaccatcacctctaacgtggtgtacggcaagaagacaggtaacacc
cccgatggccgccgcgccggagcacctttcgccccgggtgccaacccaatgcacggccgt
gatgagaaaggcgccatcgcctcactcacttccgtggccaagctgccctttgcccacgca
caggatggtatttcttacaccttctctatcgttcccaatgctctgggtaaagatgaaaag
gcccgtgagcgtaacctggcagccctgatggacggttatttccgccacagtgaaggccgt
gaaggtggccaacacctgaacgtgaacgtgatgaaccgtgaaatgcttgaggatgccatc
gcaaaccctgacaagtatccacagctcaccatccgtgtatccggttatgcagtgcgcttc
aactcactgacaccagagcaacagcaggatgtgatcacccgcacctttactcaaggtttg
taa

DBGET integrated database retrieval system