KEGG   Shewanella amazonensis: Sama_0083Help
Entry
Sama_0083         CDS       T00445                                 

Definition
(GenBank) alpha/beta hydrolase fold
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
saz  Shewanella amazonensis
Pathway
saz00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sama_0083
Enzymes [BR:saz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sama_0083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Abhydrolase_5 Lipase_3 Esterase LIDHydrolase
Motif
Other DBs
NCBI-ProteinID: ABL98295
UniProt: A1S1N9
Position
complement(92823..93776)
Genome map
AA seq 317 aa AA seqDB search
MHTPALNTSLTIPPALKALYQRCELGSLATSPGVDIAWLALEHPSPKGSIVFSNGRVEAF
LKYLELYQDFYDAGYSVYALDHRGQGLSSRLTPNRHMGHVAHFSDYVTDFNHFIDQVVRP
RAKAPLFLAGHSMGGAIGTLYLQAHSGLFSAACFSAPMYGICLPMNKVFVRWLAQKLDAS
AKGLPNYILGGKDYHPAPFAKNDLTKSEARYQAYRELYEQNPQLQLGSPTNRWLLEALDA
CDEAVLAARESKIPLLVLQASEDTIVDNKAQNRAMGGLCECLQINDARHEILMECDGPRT
KAIEAMLGFFASHAKQR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaccagctttgaatacatctttgacaattccacctgcccttaaggcgctgtat
cagcgctgtgagctgggcagcctcgccaccagccccggcgtcgacatcgcctggctggca
ctggaacaccccagtcctaagggcagcattgttttttccaatggccgggttgaggccttt
ctcaagtatctggagctgtaccaggatttttatgacgctggctacagtgtctacgcactg
gaccatcgcggtcagggtctatcgagccgtcttacgcccaaccgccatatgggccatgtg
gcgcacttcagtgactatgtcactgacttcaatcattttatagaccaggttgtgcgcccc
cgagccaaagcgccgctgtttctggctggccactccatgggcggcgccataggcaccctg
tatttgcaggcgcattcgggcctcttcagtgccgcctgtttctcggcccccatgtacggc
atctgcctgcccatgaacaaggtgtttgtgcgctggctggcgcaaaagctggatgccagc
gctaaagggctacccaactacattctcgggggcaaggactatcatccggccccctttgcc
aaaaacgacctcaccaaaagcgaggcccgttatcaggcctaccgcgagctctatgagcaa
aacccgcaattgcaactgggctcgcccaccaaccgctggctgctggaagcattggatgcc
tgtgacgaagcggtattggcggcgcgggagagcaaaatccctttgctggtgttgcaggcg
agtgaagacaccatagttgacaacaaagcccagaacagggccatgggtggactgtgcgaa
tgcttgcagattaacgacgcccgccatgagattttgatggaatgcgacggcccacgcacc
aaggcgatagaggcgatgctgggcttttttgccagccatgccaagcagcgctga

DBGET integrated database retrieval system