KEGG   Shewanella amazonensis: Sama_0535Help
Entry
Sama_0535         CDS       T00445                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
saz  Shewanella amazonensis
Pathway
saz00010  Glycolysis / Gluconeogenesis
saz00052  Galactose metabolism
saz01100  Metabolic pathways
saz01110  Biosynthesis of secondary metabolites
saz01120  Microbial metabolism in diverse environments
saz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sama_0535
   00052 Galactose metabolism
    Sama_0535
Enzymes [BR:saz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Sama_0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABL98745
UniProt: A1S2Y9
Position
complement(659093..660118)
Genome map
AA seq 341 aa AA seqDB search
MVRHSVLDAWKDPRGGEIERVRLDNGQLAIEVLSLGGIIRSLWAPDSRGERANLVLGCDS
LEDYLAQNAHLGAIAGRYANRIALGKLHYDGEDFQLDINQATNCLHGGHEGFNRKQWALG
LLPDGVRLSLSSPDGDMGFPGNCSVQLDYRLAGNNLYVEIMAMTDRPCPVNLTQHSYFNL
DGRADCLDHTVTMHARAFLRCNEAGIPTGRATTAGTPLALQDVRLGDRVQHPDLASTRGF
DHCFIIDKTQDELALAAELHSPHSGRLLKLYTNQPGVQLYGANFLDGERGRQGKIYRPYQ
GVCLEPQLFPDAPNQPDLGKAWLMPGEIYHHISRYQFEVKD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgtcactcagtgctcgacgcctggaaggatcccaggggcggagaaattgaacgg
gttcgattggacaacggccagttggccatcgaagtactgagtctgggcggtattattcgc
tcactatgggctcctgacagccggggcgagcgcgccaatctggtacttgggtgtgacagt
cttgaagactatctcgcccagaatgcgcaccttggcgccattgccggacgctatgccaac
cgtatcgccctcggcaaattgcactatgacggtgaagacttccaactggatatcaatcag
gcaaccaactgcctccatggtggccatgagggttttaatcgcaaacaatgggcgctggga
ttgcttcccgacggtgtgcgtctgagccttagcagcccagatggcgatatggggtttcca
ggcaattgctcggtccagctggattaccggctagcgggcaataacctctacgtggaaatc
atggcgatgaccgataggccctgcccggtcaaccttacccagcacagctactttaacctt
gacggacgtgccgattgtctcgatcacacagtgaccatgcacgccagggcgtttctgcgc
tgtaacgaggcagggatacccacaggacgcgccaccaccgcaggcacaccgctggcattg
caggatgttcgccttggtgaccgggtacaacacccggaccttgccagcacacgcggtttt
gaccactgttttattatcgataagacacaggacgagctggcgttggcagccgagctacac
agcccacactcgggcagactccttaaactctataccaatcagccgggcgtacagctctac
ggggcgaattttctcgatggcgaacggggcaggcagggcaaaatttatcgaccctatcag
ggtgtttgcctcgaaccacagctgtttcccgatgcaccaaatcaacccgatttgggcaag
gcctggttaatgccgggggagatttatcatcatatcagtcgttatcagttcgaggtaaaa
gactga

DBGET integrated database retrieval system