KEGG   Shewanella amazonensis: Sama_0574Help
Entry
Sama_0574         CDS       T00445                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
saz  Shewanella amazonensis
Pathway
saz00270  Cysteine and methionine metabolism
saz00480  Glutathione metabolism
saz01100  Metabolic pathways
Module
saz_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:saz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Sama_0574
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Sama_0574
Enzymes [BR:saz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     Sama_0574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ABL98782
UniProt: A1S326
Position
complement(715316..716266)
Genome map
AA seq 316 aa AA seqDB search
MIKLGIVMDPISDINIKKDSSFAMLMAAQSRGYELFYMEMQDLAMVKGEARARMHPLKVM
QNADCWFELGDAVEQPLAELDVILMRKDPPFDTEYIYATYMLERAEEAGVLIVNKPQSLR
DANEKLFTAWFSEFTPLTMVTRDAGRIREFHAEHGDIILKPLDGMGGASIFRVKQDDPNL
GVIIETLTNHGNCYAMAQVFIPEITAGDKRILVVDGEPVPYCLARIPKQGETRGNLAAGG
RGVAQPLSDADWRIAKALGPELKRRGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDVD
ITGMLMNAIEARINKK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgattaaactcggcatagtgatggaccccatcagcgacatcaacatcaagaaagactcc
agctttgccatgctgatggccgcccaaagtcgcggctatgagctgttttatatggaaatg
caggacctggccatggtcaagggtgaggcccgcgcccgcatgcatcccctcaaggtaatg
cagaacgccgattgctggtttgaattgggcgatgcagttgagcagccgctggccgagctt
gatgtcatcctgatgcgtaaagacccgccattcgacaccgaatatatttacgccacttat
atgttggaacgcgccgaagaggcgggcgtgttgattgtcaacaagccccagagcctgcgg
gacgccaacgaaaagctgtttaccgcctggttcagcgagtttactccactgaccatggtc
acccgcgatgctggccgcatccgtgagttccacgccgagcatggtgacattatcttaaag
ccgctggatggcatgggcggcgcctctatctttcgcgtcaaacaggacgacccgaacctt
ggcgtcatcatagaaaccctcaccaaccacggtaattgctacgccatggctcaggtgttt
attcctgaaatcaccgcgggcgacaaacgtattctggtggtggatggtgagccagttcca
tattgcctggcccgtatccccaagcagggtgaaacccggggtaatcttgctgccggtggc
cgtggagtagcacagccgctgtctgacgccgactggcgcattgccaaggctctggggccg
gaactcaagcgccggggtctgatttttgtgggtctggacgtgattggcgataaactcacc
gaaatcaacgtgaccagcccgacctgtatccgcgaaatcgaagcggccttcgacgtggat
atcacgggcatgctgatgaacgccatcgaagcccgtatcaacaagaaataa

DBGET integrated database retrieval system